PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna28103.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family bZIP
Protein Properties Length: 427aa    MW: 46283.4 Da    PI: 6.8478
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna28103.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.63.7e-10226274553
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                              kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l   +
  mrna28103.1-v1.0-hybrid 226 KRAKRILANRQSAARSKERKARYIQELERKVQTLQTEATTLSAQLTLFQ 274
                              9****************************************99887665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.2E-16222286IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.875224287IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.8E-8226280No hitNo description
SuperFamilySSF579598.44E-11226277No hitNo description
PfamPF001701.7E-8226277IPR004827Basic-leucine zipper domain
CDDcd147033.17E-23227276No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MSSTTPPPPQ PEPPKPMHHH SNPNPIPIPN PNPTFLPNPK DPLFLPSPAA NVKPTVISSE  60
NRAAPFTTSA ATSSSSTSSS SSSSTSTMLG SLPNTNPFIR SSTSAHHHFP ATTHRRAHSE  120
VSFRLPEDLM DLSGPDPFTS SAAAAADDEE DLFSTYIDLD KLQAGASAAT DDDSGGGGEK  180
RAASRHRHSS SVDTSSTSTG VFGEVMEAKK AMPPDKLAEL WTLDPKRAKR ILANRQSAAR  240
SKERKARYIQ ELERKVQTLQ TEATTLSAQL TLFQRDTTGL NTENTELKLR LQAMEQQAQL  300
RDALNEALKK EVERLKFATG EMMNHSESFN LGMQQMPYNN NQSAYFPITQ QQPGPAGHQN  360
MQMPPFNHSQ SSMPSNLHQP NSHTLSDIMQ NGPVGQLQGL DISNKMPHLV KSEGPSLSAS  420
ESSTTF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004296017.20.0PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P41e-100RF2B_ORYSJ; Transcription factor RF2b
TrEMBLM5VZA01e-174M5VZA0_PRUPE; Uncharacterized protein
STRINGGLYMA18G05880.21e-149(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15483497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06850.19e-80basic leucine-zipper 52