PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna27918.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 313aa    MW: 34033.1 Da    PI: 7.6894
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna27918.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like383.6e-124974126
                  G2-like  1 kprlrWtpeLHerFveaveqLGGsek 26
                             k+rlrWt++LH+rFv+a++qLGG++ 
  mrna27918.1-v1.0-hybrid 49 KQRLRWTSDLHDRFVDAITQLGGPDS 74
                             79*********************985 PP

2G2-like50.15.9e-16921222555
                  G2-like  25 ekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              + AtPk +l++m+v+gLt++hvkSHLQkYRl
  mrna27918.1-v1.0-hybrid  92 QGATPKGVLRVMGVPGLTIYHVKSHLQKYRL 122
                              569***************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-2948123IPR009057Homeodomain-like
SuperFamilySSF466893.94E-1349122IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-84974IPR006447Myb domain, plants
PfamPF002491.1E-551121IPR001005SANT/Myb domain
TIGRFAMsTIGR015576.7E-1193123IPR006447Myb domain, plants
PfamPF143791.2E-24154200IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MYHAKKFSTA SLVPHKPQSS EQLVASDSSV KNPTPSASNS ASASAGNGKQ RLRWTSDLHD  60
RFVDAITQLG GPDSGFETIM QDIRGSLPAA AQGATPKGVL RVMGVPGLTI YHVKSHLQKY  120
RLAKYLPESP ADGSKDEKKG SGDSLSCSDS SPGVQINEAL RMQMEVQKRL HEQLEVQRQL  180
QMRIEAQGKY LQKIIEEQQK LGGVLKGSDA LPSAEDKQKS SQLETHGDAS TKLPSPRKKH  240
RMDDGLLSDC TTSHLPPNTD QKDEFTGQWD QDVYPSVGGF GFNLRTELKE AEGGVAKQKG  300
PLELRPLCDS EQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-1848125159Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-1848125159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-1848125159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-1848125159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-1848125159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-1848125159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-1848125159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-1848125159Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna27918.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8285520.0FR828552.1 Rosa hybrid cultivar mRNA for putative MYB transcription factor (myb1 gene), cultivar Yellow Island.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011461370.10.0PREDICTED: protein PHR1-LIKE 1-like
SwissprotQ9SJW03e-69PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLA0A2P6RH480.0A0A2P6RH48_ROSCH; Putative transcription factor MYB-HB-like family
STRINGXP_004294699.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130132330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.17e-65G2-like family protein