PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna27722.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family Trihelix
Protein Properties Length: 377aa    MW: 43321.7 Da    PI: 6.9482
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna27722.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix75.48.9e-24124205186
                 trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                              +W  +e+++Li++r e+e++++ +k+ k+lWe+vs++m++rgf+r+++qCk+kw+nl  ryk  ++++ +    + ++cp+f++l+
  mrna27722.1-v1.0-hybrid 124 QWGPEETRELIAIRGELERDSSVAKRSKALWEAVSSRMSARGFNRTSEQCKCKWKNLLIRYKGKETSDPE----TGRKCPFFEELQ 205
                              7**************************************************************9999997....4678******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.53E-5121183IPR009057Homeodomain-like
SMARTSM007174.7E-4121183IPR001005SANT/Myb domain
PROSITE profilePS500908.269123181IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.1E-5123181IPR009057Homeodomain-like
CDDcd122031.09E-21124188No hitNo description
PfamPF138371.5E-21124206No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MEEVAGDGGG EDEVADEGSK SLVEIKNYRD IYVSHVKARP LIKHHGFRVL VTDATAPPPS  60
YPSLQATSPL SLCFSDLKAS STDDIKGQRY SHILKEEMYG GGGDEDESMG FGTMRMMVTS  120
PTGQWGPEET RELIAIRGEL ERDSSVAKRS KALWEAVSSR MSARGFNRTS EQCKCKWKNL  180
LIRYKGKETS DPETGRKCPF FEELQEVFTE RERNMQRLLL ESEAGVSRAK KRVKKGRSGR  240
SSDELSEDPD EDEDDGNGNV KKRKTERVVT PRVMNATASF GSGSGSVPEM LKEFLKQQQR  300
MEIEWREMME RRARERQLFE QEWRQRMVKV ERERLMVEKA WREREEQRRM RDESRAERRD  360
ALVTSILNKL IDETNF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004300404.10.0PREDICTED: trihelix transcription factor GT-3b-like
RefseqXP_011465302.10.0PREDICTED: trihelix transcription factor GT-3b-like
TrEMBLM5WBE21e-102M5WBE2_PRUPE; Uncharacterized protein
STRINGGLYMA01G35370.25e-92(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.14e-27Trihelix family protein