PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna26806.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family LBD
Protein Properties Length: 147aa    MW: 16328.3 Da    PI: 4.9002
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna26806.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260130.57.4e-4151041100
                   DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqq 86 
                              +CaaC++lrr+C++dC++apyfp ++p++fa vh+++Gasnv ++l++lp++ r +a+++l+yeAe+r+++PvyG+vgv+++l++q
  mrna26806.1-v1.0-hybrid   5 RCAACRYLRRRCPSDCIFAPYFPPNNPQRFASVHRIYGASNVARMLQQLPPDLRAQAADTLYYEAECRVENPVYGCVGVLSRLHEQ 90 
                              6************************************************************************************* PP

                   DUF260  87 leqlkaelallkee 100
                              +e++++ela+++++
  mrna26806.1-v1.0-hybrid  91 IEEAESELAKTRAN 104
                              *********99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.5014105IPR004883Lateral organ boundaries, LOB
PfamPF031956.0E-415102IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MISGRCAACR YLRRRCPSDC IFAPYFPPNN PQRFASVHRI YGASNVARML QQLPPDLRAQ  60
AADTLYYEAE CRVENPVYGC VGVLSRLHEQ IEEAESELAK TRANIVLNSD VGQQSQVQQI  120
DDEVEDNSSL LQAQTIVGQT QFGSSF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-3669812104LOB family transfactor Ramosa2.1
5ly0_B2e-3669812104LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00381DAPTransfer from AT3G26620Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna26806.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004308220.11e-105PREDICTED: LOB domain-containing protein 24-like
SwissprotP594686e-50LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A2P6S7J38e-82A0A2P6S7J3_ROSCH; Putative transcription factor AS2-LOB family
STRINGXP_004308220.11e-104(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.12e-42LOB domain-containing protein 24