PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna26148.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family bZIP
Protein Properties Length: 115aa    MW: 13507.3 Da    PI: 9.4864
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna26148.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.72.5e-133492563
                             CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                             +r +r+++NRe+ArrsR RKk++i+eL+ +v++L   N +L ++l +l +  ++  +e+
  mrna26148.1-v1.0-hybrid 34 RRLKRLISNRESARRSRMRKKKQIQELKHEVDQLYVANNQLYEKLIRLLEVNQRILQEN 92
                             789********************************************999998888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.8E-93094IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.4733295IPR004827Basic-leucine zipper domain
PfamPF001703.3E-123492IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.73E-113483No hitNo description
Gene3DG3DSA:1.20.5.1706.1E-1134102No hitNo description
CDDcd147021.25E-113583No hitNo description
PROSITE patternPS0003603752IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
MSHFNDISPY TYTVSTNTVF DETAAAEQSL NHERRLKRLI SNRESARRSR MRKKKQIQEL  60
KHEVDQLYVA NNQLYEKLIR LLEVNQRILQ ENAELKERVS SLQVTFTDLI DVTL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004301090.19e-78PREDICTED: basic leucine zipper 43
TrEMBLM5WVR41e-45M5WVR4_PRUPE; Uncharacterized protein
STRINGPOPTR_0015s03580.14e-30(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130442430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60830.11e-27basic leucine-zipper 70