PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna26117.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family SBP
Protein Properties Length: 515aa    MW: 56456.6 Da    PI: 8.2514
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna26117.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.38.3e-42141217278
                              -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                      SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                              Cqv+gC++dls+ k+yh+rhkvCe+hsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q 
  mrna26117.1-v1.0-hybrid 141 CQVHGCNKDLSSSKDYHKRHKVCEAHSKTAKVIVKGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQV 217
                              **************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-33136202IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.411138215IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.07E-38139219IPR004333Transcription factor, SBP-box
PfamPF031103.7E-32141214IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MESWRCSSEG KSFAPDETVS HTDSLARNRS ALMGCDLKIP CTFESQGFGE LGLPEMLGKH  60
LPRSTTSMGS PNPFFREDES SSKLSSSAVE SNSRDYSLFD LKLDAYTSKS TKGASLFSSS  120
ESSTPMKRMR VSGVYSQTAY CQVHGCNKDL SSSKDYHKRH KVCEAHSKTA KVIVKGIEQR  180
FCQQCSRFHL LAEFDDGKRS CRKRLAGHNE RRRKPQVNIH SGRDGRLLQP YNGSSFPGTM  240
FTAASFVCQD ILPSSILDAE NYRTSDWRRR VKVEGGTQHR PLSGVPETNG QLHLKPVFSY  300
DIGKHCPPAH VDDTNNLPSG SILSETGSQY PHDTRSLNSG SRSIYNEGAL GSEGFNDFHT  360
TATTVQQLSR IPESGCAHSF LSSQSQNSTS YASGIPIAHP SVMPVSQTHY NPSQVSDKLC  420
SQGSTSGVSN KFPSSGGPMT ISNGRDANDF GTNGIFQGSQ FLNTKYRLSC DGGTTVDLLQ  480
LSSELQRVDD QRHSLQVKQE YDAFCCLQSP NHVK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-281412141184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna26117.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819321e-37LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBankLN7132661e-37LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004299282.10.0PREDICTED: squamosa promoter-binding-like protein 18
RefseqXP_011464285.10.0PREDICTED: squamosa promoter-binding-like protein 18
RefseqXP_011464286.10.0PREDICTED: squamosa promoter-binding-like protein 18
RefseqXP_011464287.10.0PREDICTED: squamosa promoter-binding-like protein 18
TrEMBLA0A2P6P3800.0A0A2P6P380_ROSCH; Putative transcription factor SBP family
STRINGXP_004299282.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.13e-48SBP family protein