PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna26015.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family Nin-like
Protein Properties Length: 348aa    MW: 39970.6 Da    PI: 4.9403
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna26015.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK833e-26173222352
                   RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                              k +s e++s+yF++pi++AAkeL+v+lT+LK++CR++G++RWPhRk++sl
  mrna26015.1-v1.0-hybrid 173 KLLSRETISQYFYMPITQAAKELNVGLTLLKKRCRELGVRRWPHRKLTSL 222
                              67899******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.723158242IPR003035RWP-RK domain
PfamPF020421.9E-21175222IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MSNPNWVGVS NENPFSFANQ FSPADFSGYA PVLDWENEVP PMVQDYSFVD ALPFMETCLN  60
LHDHDPLYSS LDIQPIRSLF QGDDVLFGDN ANETENVVHN EVFASGFEHP NHDHDQQEQQ  120
QQEKQQPILL LTSNEDQNGG DREHVGEERK HKKRCMRDEV KSGSSTRSYS SSKLLSRETI  180
SQYFYMPITQ AAKELNVGLT LLKKRCRELG VRRWPHRKLT SLQTLIRNIQ VNIQELGKEE  240
DDNNEEKLRN AIELLEREKK LMEEAPDMQL EDHTKRLRQA CFKANYKKRK IMGMNLIDYP  300
PHSSNFSIVD NRGGKSMAII DNRGDEEDEE IKSLLSDSFS SSASMMI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna26015.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011465692.10.0PREDICTED: protein RKD2
TrEMBLA0A2P6P2Q21e-135A0A2P6P2Q2_ROSCH; Putative transcription factor Nin-like family
STRINGXP_004301148.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.12e-45RWP-RK domain-containing protein