PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna25537.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family HB-other
Protein Properties Length: 740aa    MW: 82299 Da    PI: 7.4715
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna25537.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.72.4e-19460157
                             TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                 Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                             +r Rt++t+ q e+Le+++  +++ps++++eeL+k+l+L  +qV+vWF NrRak+++
  mrna25537.1-v1.0-hybrid  4 KRLRTKWTPIQRETLEKAYSVEKTPSEATKEELSKQLELGYEQVTVWFMNRRAKDRR 60
                             789****************************************************97 PP

2Homeobox40.74e-1366115352
                              --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
                 Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                              k+ ++t++ql +Le+ ++++++ps ++ree+ kk+g++e qV+ W+  +R
  mrna25537.1-v1.0-hybrid  66 KKSRMTRHQLATLEKTYASEKNPSVSKREEIGKKVGMSEIQVRLWYNKKR 115
                              56679*****************************************9998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.892161IPR001356Homeobox domain
SMARTSM003891.7E-19365IPR001356Homeobox domain
CDDcd000861.30E-16461No hitNo description
SuperFamilySSF466895.56E-18461IPR009057Homeodomain-like
PfamPF000467.9E-17460IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.8E-16563IPR009057Homeodomain-like
PROSITE patternPS0002703659IPR017970Homeobox, conserved site
SMARTSM003891.1E-666125IPR001356Homeobox domain
CDDcd000861.45E-866126No hitNo description
PfamPF000468.9E-1166116IPR001356Homeobox domain
PROSITE profilePS5007112.47166121IPR001356Homeobox domain
SuperFamilySSF466891.03E-966119IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.7E-1168125IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 740 aa     Download sequence    Send to blast
MAIKRLRTKW TPIQRETLEK AYSVEKTPSE ATKEELSKQL ELGYEQVTVW FMNRRAKDRR  60
QGLVAKKSRM TRHQLATLEK TYASEKNPSV SKREEIGKKV GMSEIQVRLW YNKKRFEDQG  120
KERKKRGPGA KKAPKSALSS SCDHLAFVSA DLTGIPNPDT PCKRLLLFSS GSKDVFCSVD  180
LTNGHLFQHF KQTDHCLAEP SSSSRLETPD ASKDSSSSSR LENLDALMVD VTDLISKPSP  240
CPNFHPLEDN LFVDQDKLAV AKKGLQKIFD CGLEALADPH VQEEFLAYSA AVLSVDSCPS  300
DLKVILSSFR GNLSEQTCAF LQAQHELKVA SDLSASITER RFVLRYHHSK YAEVKKQIIA  360
SDEKVANLKA MIKRLEASLA EEKSNREKID RVLDSIETGV MDARDGLLSD IEQVSAMEGT  420
TKAANQLVAQ RHSAWENLRS TFTEDTLCSA SGNRHMGEHY EQTDHCIAIH CSSAITTWLP  480
FLVIPLPFPF LTLPAKGDKA LSLYQLQVTA RIFFYKLQAQ ARMGRSSSSK LESIDAIIVD  540
VTDILSKRCP SIIDHPQLDA QSFVGQDELA LAKEGLQKIF DCGLKALADP VVQEEFLFCS  600
TTVLSAESCP SELKVKLSSF RCNLAEETSA FMKAQADLKV KKEMVASGEK VANFKAMIKE  660
LEAQIKRLEA CLATEESNRE KIDEAINSIE NQVTTARDGL VSDLAQVSSI EGSIQAANKL  720
VAQKKLDWDN LKLSFTKFA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15259NRRAKDRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011457861.10.0PREDICTED: uncharacterized protein LOC101313073
TrEMBLM5VHQ22e-98M5VHQ2_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF949422
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28420.14e-12homeobox-1