PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna24915.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family HB-other
Protein Properties Length: 1044aa    MW: 114841 Da    PI: 6.7988
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna24915.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox17.85.7e-0680136157
                              TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                 Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                              +r+R  ++++ ++ ++++F  +  ++++e +eL++  g++ +qV+ +F  +R + +k
  mrna24915.1-v1.0-hybrid  80 KRPRDLLNPKAIKYMQSVFSVKDAITKKESRELSALFGVSVSQVREFFNTQRSRVRK 136
                              799**************************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.91277137IPR001356Homeobox domain
SuperFamilySSF466891.5E-678139IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-579144IPR009057Homeodomain-like
SMARTSM003892.2E-479141IPR001356Homeobox domain
CDDcd000861.32E-480136No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1044 aa     Download sequence    Send to blast
MEDPSELEIG NSVVSFHKFV DSQRQLFHSQ IDELQKIVVT QCKLTGANPL SQEMAAGALS  60
INIGESWKCD CLVLIVLNGK RPRDLLNPKA IKYMQSVFSV KDAITKKESR ELSALFGVSV  120
SQVREFFNTQ RSRVRKIVQL SREKAIRSTE HKGLLEGVPT SFDPLVPINP LPLNTIGPSN  180
VNPLPLNTIG PSDVNLLPLN TIGPSDVNPL PLNTIGSSNS NPLPLNTVGP SNVEDAPSCS  240
TQDDTPPGLD DVDKHFVENI FNLMRKEETF SGQVKVLELI LRIQNSSVLC WFLTKGGVMI  300
LVTWLTQAAD EEQTSVILVI LKVLCHLPLS KALPAHMSAI LQSVNRLRFY RTSAIGDDPW  360
NSNGDVHENI LALPFESADR LRKSESSEPM KLLTASSDDL NKKHILGVSS SRILHIEFVI  420
VLSQPGQKTA GRSSQAARAT PVSQARPMSV DDIQKAKLRA QYMQSKYGKS ASSNENKEVK  480
AEGVNKLPVS QASTLPVVSI VPVQSSIEES KKPATLPFKE RETPDMSVQS IASFQPIAPK  540
LKTDIKEHIW EKCRRVQVPW KTPPEIKLNP EWRVGGGENG KEMEVQKNRN HREQETIYKT  600
LKEIPPNPKE PWDIEMDYDD SLTPVIPTEQ PPDSDCTETQ PSHSQEVNNA AETLAPPPQG  660
VNSVISPPTN TASSTAAPDL ELLAVLLKNP ELVFALTSGQ AANLSSEDTV KLLDMIKAGG  720
AGFAGSLNGL ASKMEEKVEV SLPSPTPSSD PGTSGWRPEA TRNAFSQQNS MQNRVSPGYS  780
SPAMVANNSV LSQLPSALTS PLPQRLLGAQ QAVPAYSPEH VHQIPHSTTV PSHLQHNYSN  840
MAVPSVWGES TSNRKPGPLY NSYNVAAERQ PNSLPPPFLP TLTHQQRHSP QPLQQQTPYS  900
ESHYSESPQY SESPYFSKPP TVKQGPPLSD SWRSGRQGLP SNYHYLENQN QYYNAPPSYG  960
GPLQQQPQLR SGPPCEGNEF VNNGGGFESW SPPEDSPARN AEYNMYGRNA YRPVERSRQT  1020
QTPGYRDYSR QGQTWPDRGR FTQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011470994.10.0PREDICTED: homeobox protein LUMINIDEPENDENS
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLM5VIN40.0M5VIN4_PRUPE; Uncharacterized protein
STRINGPOPTR_0002s20990.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-132HB-other family protein