PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna24269.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 327aa    MW: 36548.7 Da    PI: 5.797
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna24269.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.87.6e-3162115255
                  G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                               rlrWt++LH++F++av+qLGG++kAtPk+i+++m+v+gLtl +vkSHLQkYRl
  mrna24269.1-v1.0-hybrid  62 SRLRWTSDLHASFLDAVSQLGGPHKATPKSIMHIMGVQGLTLFQVKSHLQKYRL 115
                              69***************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.6E-1661115IPR009057Homeodomain-like
TIGRFAMsTIGR015579.7E-2561116IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.7E-2762115IPR009057Homeodomain-like
PfamPF002491.8E-763114IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MFGCEEEQGL QGPRAPNMDH GVAEGEEEEE EVEQEESSND HSDSHIKPVA PPYVPPCYKL  60
NSRLRWTSDL HASFLDAVSQ LGGPHKATPK SIMHIMGVQG LTLFQVKSHL QKYRLGKYGM  120
KEWREGSSSR TEDTVSQVLK RQETVTSTPS LSLLLPHENE NWNAGRKLKR NFVCEMRQVQ  180
KHLQLRQEAQ SRYLSRAVEN ACEKLAHQFL GGCAADYAGV FEQNAAGVEI MGSKPHQKDL  240
HLNPAYHMTQ TMQLSFENQI ASSQPPSEAH FATGDHLISD EHSRNSSVQH LLTFKIDVNR  300
EDESLVDDPA EAYLILDTSE MGSGKS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-1762118359Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-1762118359Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A4e-1762118258Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-1762118258Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-1762118258Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-1762118258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-1762118359Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-1762118359Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-1762118359Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-1762118359Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-1762118359Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-1762118359Protein PHOSPHATE STARVATION RESPONSE 1
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna24269.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011467632.10.0PREDICTED: myb family transcription factor APL-like isoform X1
RefseqXP_011467633.10.0PREDICTED: myb family transcription factor APL-like isoform X1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2592122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.21e-34G2-like family protein