PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna24094.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 368aa    MW: 41136.1 Da    PI: 6.2866
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna24094.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.14.2e-33229284156
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                              k+r++W+peLH+rFv+a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  mrna24094.1-v1.0-hybrid 229 KQRRCWSPELHRRFVDALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 284
                              79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.271226286IPR017930Myb domain
SuperFamilySSF466891.43E-18226287IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-29228287IPR009057Homeodomain-like
TIGRFAMsTIGR015574.6E-27229284IPR006447Myb domain, plants
PfamPF002494.3E-8231282IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MELSLDSNVV FVPKTISEFL FQLSAVKDGA DRSSKLAEYR KRLEDEMRKI EVFKRELPLC  60
MVILKDAIER LKEEVMQCGE VEDRTVVVEE FIPMKKKKDE NEGVVSEKEN SDMKSWMSSV  120
QLWSTNVDHS KSELNLRNEE DDRSVPENPI EMSKKRSRGG AFVPFKGNYV KEGNEVSEVP  180
SLSLMTPMCE VGGSNNGNSK SSARGGSGLS LVKLQIEAQQ LSQQQCFRKQ RRCWSPELHR  240
RFVDALQQLG GSQVATPKQI RELMQVDGLT NDEVKSHLQK YRLHVRKVPA SSAAEANGLW  300
MNQDHCGDNS KANTSQSRSP QGPLPRTEFA KGGQSTTGGD STETEEDDQK SDGYSWKGAR  360
HNSSGDV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-13229282255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-13229282255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A8e-14229282154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B8e-14229282154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C8e-14229282154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D8e-14229282154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-13229282255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-13229282255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-13229282255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-13229282255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-13229282255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-13229282255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00629PBMTransfer from PK14402.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna24094.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004288067.10.0PREDICTED: probable transcription factor KAN4
TrEMBLA0A2P6RN790.0A0A2P6RN79_ROSCH; Putative transcription factor MYB-HB-like family
STRINGXP_004288067.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.14e-61G2-like family protein