PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna22889.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family SBP
Protein Properties Length: 1167aa    MW: 127631 Da    PI: 6.7294
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna22889.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.82e-40147223177
                              --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                      SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                              +Cqve+C+adls+ak+yhrrhkvC +hska+++lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+ 
  mrna22889.1-v1.0-hybrid 147 ACQVEDCRADLSNAKDYHRRHKVCVMHSKASEALVGNVMQRFCQQCSRFHVLKEFDEGKRSCRRRLAGHNKRRRKTL 223
                              5*************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.2E-32142209IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.59145222IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.28E-37147226IPR004333Transcription factor, SBP-box
PfamPF031101.0E-28148221IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.202.0E-69081047IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484032.49E-89341050IPR020683Ankyrin repeat-containing domain
CDDcd002049.20E-89391048No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1167 aa     Download sequence    Send to blast
MEAFGAKGRG FYGPVATEMR GVGKRSLEWD LNDWKWDGDL FAASPLNSVL SDCRSRQLFP  60
AAPGTPSNAG LSNSCSSGSD DVSPGGNEKG KREVEKRRRG GAVENGQLND EARSLNLNLG  120
GQAYPIVEGE GNAGKKTKIA GNSNRAACQV EDCRADLSNA KDYHRRHKVC VMHSKASEAL  180
VGNVMQRFCQ QCSRFHVLKE FDEGKRSCRR RLAGHNKRRR KTLPDTADFR PYGAARVRAS  240
TPADSSSFPD HFPSPASPPN SSFPARSPKT SNLGDLAGKL EFGGLAGDGK WSGKLLESAG  300
VEACPHRRRT LLSFLSEIQS VALIVVVGGV DEHLCSLPSI TGVKLVSYME LVSQFSGQID  360
LFEVLGDLAG KLQFGGLAGG WKVVGEAAGV CWGGDAPSPA PYANSSDQAK DQDLLSHLLK  420
SLASLAGTVD GRNISALLQA SQGLPNTGSS VKTAQQVPDT VSNVYEPSRP SVSASSMDDC  480
VIIEEPLRPV GQCLKSPASD MQKRGFSVDG DLGSQILSGL QGSKPLPSRE SALTKAVTPD  540
YGRIQLLEID LNSPYDDSHD DLENLGSCHV PINPGIHHDS HKSSPPQTSR NSDSTFTQSP  600
SSSSGESQNR TDRIVFKLFG KDPNELPYVL RSQIIDWLSH SPTEIESYIR PGCIVLTIYL  660
RLEKSMWEEL CCHLGSNLQK LLDAANDPFW RTGWIYTRMQ HFVAFMYNGQ VVLDAPLPLK  720
SHKSSRISSI KPIAVSSSER AQFVVKGFNL PHSTRLLCAL EGKYLAQEAC DDLMDGADTT  780
VEHDELQCLK FSCSIPNVTG RGFIEVEDLG LSSNFFPFVV AEQEVCSEIC MLEDVIEAAE  840
TADDIQAEPE ILETKNRAMD FIHELGWLLH RSHVKFRLGH LDPNLDLFPF GRFKLLMEFS  900
VDHDWCAVVK KLLKLLFDRT VDAGEHSSVE LALLDMALLH RAVQRNSRPM VELLLRFVPD  960
KGLESEQKKQ VEGEGNNFLF KPDGVGPLGL TPLHVAASID GCEHVLDALT DDPGKVGIEA  1020
WKNARDSTGM TPYDYASMQG RYSYINLIQR KISKKLESGH VVVDIPGTIL ESNSKQKQSD  1080
GHRSSKVASF DTEKFDIKAL MRGDCKLCSQ KLAYGSRRSL VYRPAMLSMV AIAAVCVCVA  1140
LLFKSTPEVV FIFHPFRWEH LKFGSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-29140221384squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000269|PubMed:16554053}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna22889.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004297084.10.0PREDICTED: squamosa promoter-binding-like protein 12
SwissprotQ9S7P50.0SPL12_ARATH; Squamosa promoter-binding-like protein 12
TrEMBLA0A2P6QZK70.0A0A2P6QZK7_ROSCH; Putative transcription factor SBP family
STRINGXP_004297084.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15393495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Jung S, et al.
    Synteny conservation between the Prunus genome and both the present and ancestral Arabidopsis genomes.
    BMC Genomics, 2006. 7: p. 81
    [PMID:16615871]
  2. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  3. Chao LM, et al.
    Arabidopsis Transcription Factors SPL1 and SPL12 Confer Plant Thermotolerance at Reproductive Stage.
    Mol Plant, 2017. 10(5): p. 735-748
    [PMID:28400323]