PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna22888.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family SBP
Protein Properties Length: 1034aa    MW: 114676 Da    PI: 6.8971
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna22888.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP125.22.7e-39149226178
                              --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                      SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                              +Cqve+C+adls+ak+yhrrhkvC++h++a+ ++v ++ qrfCqqCsrfh l+efDe+krsCr+rLa+hn+rrrk+++
  mrna22888.1-v1.0-hybrid 149 VCQVEDCKADLSHAKDYHRRHKVCHMHARATRAMVGNILQRFCQQCSRFHVLQEFDEGKRSCRKRLAGHNRRRRKTHP 226
                              6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.7E-31144211IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.505147224IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.24E-36148230IPR004333Transcription factor, SBP-box
PfamPF031102.3E-28150223IPR004333Transcription factor, SBP-box
SuperFamilySSF484031.87E-7768917IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.204.0E-6803911IPR020683Ankyrin repeat-containing domain
CDDcd002047.22E-7804909No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1034 aa     Download sequence    Send to blast
MEAFGGKPRS LYGPVVPDME AVGKRSLEWD LNDWRWDGHV FTATPLNSVP SDCRSRQLFP  60
IGPETPSNAG WSNSSSSGSD EIGLGNEKGK RELEKRRRGV IVENEEVDDE AGSLNLKLGG  120
QVYPILEEDV KTGKKMKTKI VGTTSNRAVC QVEDCKADLS HAKDYHRRHK VCHMHARATR  180
AMVGNILQRF CQQCSRFHVL QEFDEGKRSC RKRLAGHNRR RRKTHPDTVV NGGSMNDERG  240
SSYILVTLLR ILSNMQSNSS DQTKDQDLLS HLLKNLDNNN GTTDGRNVSA LLQGSQVLLN  300
GGASVQTVQK VPHLDFNGSE PGRPSVSTSK MDDCINLDGH LRPTGQCPTG PASDKLLNMI  360
SPAGGDLGSQ ALSGVQTTKS FSSRYSLPSK PVAQEYGRIQ LNEIDLNNTY DDSQEYLENL  420
GRSHFPVNPG SESHGDPFSI QHDSQKSSPP QTSGNSDSTA TQSPSSSSGE AQSCTDRIVF  480
KLFGKDPSDL PFGLRSQILG WLSSTPTDIE SYIRPGCIIL TIYLRLEKST WEELCYHLGS  540
SLVKLLDASS DPLWRTGWVY TRVQHVVAFV YNGQVVLDTP LPLRSHKTCR ISCIKPIAVS  600
LSEGAEFVVK GFNLSSSTTR LLCALEGKYL AQETCHDLME GTDTTSEHDE LQCLRFSCSI  660
PDVTGRGFIE VEDHGLSSSF FPFIVAEQEV CSEICMLEAA IEVADFANDL QTDPEIMEAK  720
NQAMDFIHEL GWLLHKSRVK FRLGQTDPKL DLFSFQRFRL LMEFSMERDW CAVVKKLLGI  780
LYEGTVDAGE HLSIELALLD MGLLHRAVQR NCKPMVEFLL RFVPDKGLDK AELEEKQQVD  840
RNINRFLFKP DVVGPMGLTP LHVAASTDGC EYVLDALTND PGKVGIKAWK TARDSTGLTP  900
YDYACLRGRY SYLHIVQRKI SKAESGHVVL DIPGTILDKN TKQKQIDGHK SSKISSFHTE  960
KIAMKEIQGD CKLCCQKLAY GGSTRSLLYR PAMLSMLAIA AVCVCVALLF KSSPEVVFVF  1020
QPFRWELLKY GPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-281492231084squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna22888.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004297083.10.0PREDICTED: squamosa promoter-binding-like protein 12
TrEMBLA0A2P6QZL30.0A0A2P6QZL3_ROSCH; Putative transcription factor SBP family
STRINGXP_004297083.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15393495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1