PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna22660.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family SBP
Protein Properties Length: 381aa    MW: 41035.2 Da    PI: 9.672
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna22660.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP138.81.5e-4378155178
                              --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                      SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                              +CqvegC++dls++k y++rhkvC +hsk+p+v+v+gleqrfCqqCsrfh+l efD++krsCrrrLa+hnerrrk+q+
  mrna22660.1-v1.0-hybrid  78 RCQVEGCNVDLSDVKAYYSRHKVCAMHSKTPTVVVAGLEQRFCQQCSRFHQLPEFDQGKRSCRRRLAGHNERRRKPQP 155
                              6**************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.7E-3573140IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.53976153IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.37E-4277158IPR004333Transcription factor, SBP-box
PfamPF031105.3E-3379152IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048653Biological Processanther development
GO:2000025Biological Processregulation of leaf formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MGSTSLTTTT DSGGSSSSSP PNNNSTDDSL HGLKFGRKIY FEDGTLAPPK SGSSSSAGVK  60
KQRSSGGGGF VHHGQPPRCQ VEGCNVDLSD VKAYYSRHKV CAMHSKTPTV VVAGLEQRFC  120
QQCSRFHQLP EFDQGKRSCR RRLAGHNERR RKPQPGSMMS TRFGRLSSSI YENSNRVGSF  180
LMDFTAYPRD GRDAWATART SERPPANQTV TATGKFLQHQ WQSNPENNRS NLYLQGSAGG  240
TSYPGPGIPP GECVTGVTDS SCALSLLSSQ PWASRNRGVG TNAFLNTQGA PMAQSISNAG  300
PVNPFPTTSW GFKGNEAGSS SHEMLPDLGL GQISQPLNSH YSGELELSQQ GRRQQNMELG  360
NSRGYSRGYD SSSQQIHWSL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-31791521184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00307DAPTransfer from AT2G42200Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna22660.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794570.0JN979457.1 Fragaria x ananassa cultivar Allstar SQUAMOSA promoter binding protein-like protein (SPL9) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004304380.20.0PREDICTED: squamosa promoter-binding-like protein 9
TrEMBLG9JWE90.0G9JWE9_FRAAN; SQUAMOSA promoter binding protein-like protein
STRINGXP_004304380.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42083359
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.13e-63squamosa promoter binding protein-like 9