PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna22647.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 404aa    MW: 45379.4 Da    PI: 7.1889
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna22647.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.83.8e-31230284155
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              k+r+rW+++LHe+Fve+v++LGG++kAtPk+il++m+++gLt+ hvkSHLQkYR+
  mrna22647.1-v1.0-hybrid 230 KTRIRWNQDLHEKFVECVNRLGGADKATPKAILKMMGLEGLTIFHVKSHLQKYRI 284
                              68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.497227287IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-27228285IPR009057Homeodomain-like
SuperFamilySSF466893.76E-16228284IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-22230285IPR006447Myb domain, plants
PfamPF002499.2E-9234283IPR001005SANT/Myb domain
PfamPF143792.5E-18315361IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MNEQKIDCQE RIYQHNHGLI SDSNFELGSH SSHQLLDLQQ LPWNMGVWVQ QPTTDQGVSQ  60
LQNLGPEKSP SSIMSRFESP ASLFYAAERC MGFPAHYESQ DGGSPNLPQF PSGQSFVESY  120
SMESSEDIRN TLQSIVKSQT NSSQSYKSFE KSNQIPNNNL RGNKLFLHQH MNQDSTTASV  180
RRPFSLAFKE NQEQVSFFSQ QAKQSSRTSS GTTSATYADS SSTSPSLSSK TRIRWNQDLH  240
EKFVECVNRL GGADKATPKA ILKMMGLEGL TIFHVKSHLQ KYRIAKYLPD SAEGKSEKRA  300
NVNVEPQLDV KTGLQITEAL QLQLDVQRQL HEQLEIQRKL QLRIEKQGEQ LKKMFDLQQK  360
TSDNMSKTPN VDFTCHEDGP SNNEIQVSSP EGSGNSHFPS KIS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-22230287259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-22230287259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-22230287259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-22230287259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-22230287259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-22230287259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-22230287259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-22230287259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna22647.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004304375.10.0PREDICTED: probable transcription factor KAN3
RefseqXP_011468060.10.0PREDICTED: probable transcription factor KAN3
TrEMBLA0A2P6RDL20.0A0A2P6RDL2_ROSCH; Putative transcription factor MYB-HB-like family
STRINGXP_004304375.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37403465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.11e-66G2-like family protein