PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna21832.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family bZIP
Protein Properties Length: 160aa    MW: 17975 Da    PI: 6.7855
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna21832.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.75.2e-133088563
                             CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                             ++ +r+ +NRe+ArrsR RK++ ++ L+  +++L +eN++  + l+  ++++ + ++e+
  mrna21832.1-v1.0-hybrid 30 RKRKRMLSNRESARRSRMRKQKHLDDLTAQMAQLRKENHQIVSSLNITSQHYMNIEAEN 88
                             67899*************************************99999988888777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.6E-101973No hitNo description
SMARTSM003381.7E-162690IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.4042891IPR004827Basic-leucine zipper domain
PfamPF001701.4E-103086IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.7E-123083No hitNo description
CDDcd147022.69E-193182No hitNo description
PROSITE patternPS0003603348IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MASSSGTSSV SSMIQNSGSE EDLQALMDQR KRKRMLSNRE SARRSRMRKQ KHLDDLTAQM  60
AQLRKENHQI VSSLNITSQH YMNIEAENSV LRAQAAELSN RLQSLNEIIT FLNANNGGCV  120
EDSSNNNNFT EPSADCFFNP LNFSYLNQPI MASAEMFQY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12950RKRKRMLSNRESARRSRMRKQK
24249RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00239DAPTransfer from AT1G75390Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN0213997e-95JN021399.1 Prunus persica bZIP transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004289640.11e-114PREDICTED: ocs element-binding factor 1
TrEMBLI6MK313e-77I6MK31_PRUPE; BZIP transcription factor
STRINGPOPTR_0004s16560.15e-73(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61334147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.11e-52basic leucine-zipper 44