PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna21344.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family bZIP
Protein Properties Length: 365aa    MW: 40093.3 Da    PI: 6.2962
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna21344.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.34.5e-10161217561
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                              kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l   +     l s
  mrna21344.1-v1.0-hybrid 161 KRAKRILANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQRDTTGLSS 217
                              9****************************************9998877666655555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.7E-16157221IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.737159222IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.8E-10161216No hitNo description
PfamPF001707.6E-9161218IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.03E-11161212No hitNo description
CDDcd147031.89E-23162211No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MQDPANPKPD PNPAPTPDSS RAPMTTSFQD PSTTPSFRGS YHRRAQSEVH FRILDDLDLL  60
QDPFDGPSNS FEELGSEDDL FCTYMDIEKL GSKLEDGSSG GQKVENAGGG GAASQAEAGE  120
GSNARPRHRH SSSMDGSLES IEAKKAMAPE KLAELWAVDP KRAKRILANR QSAARSKERK  180
ARYISELERK VQTLQTEATT LSAQLTLFQR DTTGLSSENT ELKIRLQAME QQAQLRDALN  240
DALKKELERL KIATGEALTH TDSYNLGMHH FPYSQSSFFP GQPQSGPRDS QNIQLPQYHQ  300
FQSNMQAPHQ PMLGASAQSH ACSDMLQQDS IGRFQGLDIN NRGGSHLVKP EGPSISTGET  360
NRRF*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004307733.10.0PREDICTED: transcription factor RF2b
SwissprotQ6S4P41e-105RF2B_ORYSJ; Transcription factor RF2b
TrEMBLM5XK210.0M5XK21_PRUPE; Uncharacterized protein
STRINGVIT_13s0067g02900.t011e-166(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15483497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-109bZIP family protein