PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna21073.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 391aa    MW: 43484 Da    PI: 7.6152
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna21073.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.28.8e-342983155
                  G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                             kprl+Wtp+LHerF+eav+qLGG++kAtPkt+++lm+++gLtl+h+kSHLQkYRl
  mrna21073.1-v1.0-hybrid 29 KPRLKWTPDLHERFIEAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRL 83
                             79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.0142686IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-312784IPR009057Homeodomain-like
SuperFamilySSF466897.88E-172884IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-232984IPR006447Myb domain, plants
PfamPF002494.5E-103182IPR001005SANT/Myb domain
PfamPF143791.3E-23130177IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MAIPPETHRL LQPESCPEDS GLVLSTDAKP RLKWTPDLHE RFIEAVNQLG GADKATPKTV  60
MKLMGIPGLT LYHLKSHLQK YRLSKNLHVH ANSGGTTKIV AVAVPGERIS EVNGTHMNNM  120
SIGPQSNKGI HINETLQMQI EVQRRLHQQL EVQRHLQLRI EAQGKYLQSV LEKAQETLGR  180
QNLGTVGLEA AKVQLSELVS KVSTQCLNSA FTEMKEVQGS CPQNPPTDCS MESCLTSSEG  240
SKKDQEIQNN SRMGLRAYNS SRVLLESEKT MLHLKENSMF VSTLTKNADQ RMFPSEPRSG  300
DFSMSIGLER EILNGSHCNS EERFKARNTI DSFLDNKNNR ADSVKVDQSR KVSQGYSGPY  360
FAAKLDLNSH DDTDASSSCK QFDLNDFSWS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-212885158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-212885158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-212885158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-212885158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-212885158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-212885158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-212885158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-212885158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that may activate the transcription of specific genes involved in nitrogen uptake or assimilation (PubMed:15592750). Acts redundantly with MYR1 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:15592750}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna21073.1-v1.0-hybrid
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by nitrogen deficiency. {ECO:0000269|PubMed:15592750}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004288533.10.0PREDICTED: uncharacterized protein LOC101304811
RefseqXP_011468727.10.0PREDICTED: uncharacterized protein LOC101304811
SwissprotQ9SQQ91e-128PHL9_ARATH; Myb-related protein 2
TrEMBLA0A2P6RHP80.0A0A2P6RHP8_ROSCH; Putative sterol 14-alpha-demethylase transcription factor MYB-HB-like family
STRINGXP_004288533.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38523163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-130G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Nakano Y,Naito Y,Nakano T,Ohtsuki N,Suzuki K
    NSR1/MYR2 is a negative regulator of ASN1 expression and its possible involvement in regulation of nitrogen reutilization in Arabidopsis.
    Plant Sci., 2017. 263: p. 219-225
    [PMID:28818378]