PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna21039.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family LBD
Protein Properties Length: 174aa    MW: 19016.6 Da    PI: 5.9731
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna21039.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.81.1e-4491081100
                   DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqq 86 
                              +Ca+Ck+lrr+Ca+dC++apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r+da+sslvyeA+ar+rdPvyG+vg i+ lq+q
  mrna21039.1-v1.0-hybrid   9 PCASCKLLRRRCAQDCIFAPYFPSDDPHKFAIVHKVFGASNVSKMLQELPVHQRTDAVSSLVYEANARVRDPVYGCVGAISCLQNQ 94 
                              7************************************************************************************* PP

                   DUF260  87 leqlkaelallkee 100
                              +++l+ +la++++e
  mrna21039.1-v1.0-hybrid  95 VSELQMQLAVAQAE 108
                              *********99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.8518109IPR004883Lateral organ boundaries, LOB
PfamPF031954.1E-449106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MAGGNGTSPC ASCKLLRRRC AQDCIFAPYF PSDDPHKFAI VHKVFGASNV SKMLQELPVH  60
QRTDAVSSLV YEANARVRDP VYGCVGAISC LQNQVSELQM QLAVAQAEIL CIQMQQESTV  120
LPSQPIDSCI DNERTYFLNN SLPQYLNFPS SSSSNVIHDS LKMEGIFGHD MVS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011469944.11e-127PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW32e-75LBD12_ARATH; LOB domain-containing protein 12
TrEMBLM5X1C11e-96M5X1C1_PRUPE; Uncharacterized protein
STRINGVIT_13s0067g01880.t016e-91(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-76LBD family protein