PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna21014.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 375aa    MW: 41888 Da    PI: 9.1376
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna21014.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.11.4e-3186139255
                  G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                               rlrWtp+LH rF++ave+LGG+e+AtPk +l+lm++kgL+++hvkSHLQ+YR+
  mrna21014.1-v1.0-hybrid  86 SRLRWTPDLHLRFIHAVERLGGQERATPKLVLQLMNIKGLSIAHVKSHLQMYRS 139
                              69***************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.0E-2982140IPR009057Homeodomain-like
PROSITE profilePS5129411.8582142IPR017930Myb domain
SuperFamilySSF466898.06E-1583140IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-2385141IPR006447Myb domain, plants
PfamPF002491.1E-987138IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MKKSSEGTSQ APEASLSSSS QSKKEHDVDE EKEEEDEEVV DKDRQQQPSS KNGGVSSSSS  60
TIEENEKSKG ASGGGSVRQY VRSKNSRLRW TPDLHLRFIH AVERLGGQER ATPKLVLQLM  120
NIKGLSIAHV KSHLQMYRSK KMEDPNQVLS EQGFYTEGGD NHIYNLTQLS MLQSLNHQWP  180
SSGLRYGADA SWRGRHDNRH QIYSPYSRTQ LFDHHNTRVS GLYGSVAERI FGSNNSTSTT  240
TTTAATAPNT IQFHTNHIQS AWRSRHQISI RVHDELRPFN RHSWQDHSRL DNSNETRNTL  300
KRKAPESSDN TSDLDLNLSL KVPATEEKVL GFGLSLSLSP SSSSSKLGLM KKQEGNGDPD  360
REHGRNASTL DLTL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-1686141257Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-1686141257Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-1686141257Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-1686141257Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00301DAPTransfer from AT2G40260Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna21014.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004307667.10.0PREDICTED: uncharacterized protein LOC101309095
TrEMBLA0A2P6SLF20.0A0A2P6SLF2_ROSCH; Putative transcription factor MYB-HB-like family
STRINGXP_004307667.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23783482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.19e-43G2-like family protein