PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna20491.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family WOX
Protein Properties Length: 190aa    MW: 21832.8 Da    PI: 9.0701
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna20491.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.14.2e-2084144257
                              T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                 Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                              r+R+t++++qle+Le+ +++ n +p +++ +e++k+l    ++te++V++WFqNrRa+ k+
  mrna20491.1-v1.0-hybrid  84 RQRWTPSNTQLEILERIYNEaNGTPGKHRVKEITKELsqhgHVTETNVYNWFQNRRARSKR 144
                              89*****************99**************************************97 PP

2Wus_type_Homeobox93.51.9e-3083146265
        Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                              ar+RWtP+++Q++iLe++y+++  tP k+++++it+eL+++G+++++NV++WFQNr+aR+++kq
  mrna20491.1-v1.0-hybrid  83 ARQRWTPSNTQLEILERIYNEANGTPGKHRVKEITKELSQHGHVTETNVYNWFQNRRARSKRKQ 146
                              789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007114.34980145IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-1680148IPR009057Homeodomain-like
SuperFamilySSF466896.42E-1882147IPR009057Homeodomain-like
SMARTSM003891.3E-1182149IPR001356Homeobox domain
PfamPF000461.0E-1784144IPR001356Homeobox domain
CDDcd000863.44E-1284146No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MEGQRRVLAV KLERLRTQNP DGFCVMTDDQ VEQLQKQIAV YAVICEQLVD MHKAFTAQQD  60
LAGMKMGNVY GDLMPFGGNK VTARQRWTPS NTQLEILERI YNEANGTPGK HRVKEITKEL  120
SQHGHVTETN VYNWFQNRRA RSKRKQSVPT RNMTELDIEP EVISPKDKKT KPEDMYFRSP  180
DSGIENFFA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137145RRARSKRKQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna20491.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004300539.11e-138PREDICTED: WUSCHEL-related homeobox 8-like
SwissprotQ5QMM32e-59WOX8_ORYSJ; WUSCHEL-related homeobox 8
TrEMBLA0A2P6PBJ91e-121A0A2P6PBJ9_ROSCH; Putative transcription factor Homobox-WOX family
STRINGXP_004300539.11e-137(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18553493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.19e-57WUSCHEL related homeobox 13
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]