PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna19866.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 288aa    MW: 31812.5 Da    PI: 7.8485
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna19866.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.27.7e-333185155
                  G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                             kprlrWt +LH+rFv+av+qLGG+ kAtPk+i+++m+vkgLtl h+kSHLQkYRl
  mrna19866.1-v1.0-hybrid 31 KPRLRWTADLHDRFVDAVTQLGGAAKATPKAIMRTMNVKGLTLFHLKSHLQKYRL 85
                             79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-312886IPR009057Homeodomain-like
TIGRFAMsTIGR015576.7E-243186IPR006447Myb domain, plants
SuperFamilySSF466892.87E-163187IPR009057Homeodomain-like
PfamPF002494.9E-73384IPR001005SANT/Myb domain
PfamPF143791.9E-15119164IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MFPRLVQPPP LEGIEDMHRA DPCLVLTSDP KPRLRWTADL HDRFVDAVTQ LGGAAKATPK  60
AIMRTMNVKG LTLFHLKSHL QKYRLGKQSG KDMDEVSKDD CHFALKCLVL PNINFRGYEV  120
KEALRVQMEV QSKLHVQVEA EKHLQIRQDA ERRYMAMLER ACKMLADQFI GGSVIDTDGH  180
KCQVLGNKNP KSSSLDPLGF YSLQSTDVAG VHGQEEVLTS FQPQRADCST ESCLTSHESP  240
GGLTLEGSPG GGKTRMLSLE SATASLIWGE AKVRTQVEAH GMTRYAI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-183187157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-183187157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-183187157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-183187157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna19866.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT8934051e-168KT893405.1 Prunus persica cultivar Jinliuzaohong Myb family transcription factor APL (APL) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011460083.10.0PREDICTED: myb family transcription factor APL-like
TrEMBLA0A2P6Q1U61e-173A0A2P6Q1U6_ROSCH; Putative transcription factor MYB-HB-like family
STRINGXP_004293427.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66183349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.11e-55G2-like family protein