PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna19641.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 300aa    MW: 33541 Da    PI: 9.3282
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna19641.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like993.3e-3167120255
                  G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              prlrW+++LH++Fv+ave+LGG+++AtPk il++m+vkgLt++hvkSHLQ+ R+
  mrna19641.1-v1.0-hybrid  67 PRLRWSSDLHRCFVHAVERLGGEDRATPKLILQIMNVKGLTISHVKSHLQMCRS 120
                              8**************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.95863123IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-3063122IPR009057Homeodomain-like
SuperFamilySSF466891.72E-1465120IPR009057Homeodomain-like
TIGRFAMsTIGR015578.8E-2467120IPR006447Myb domain, plants
PfamPF002492.9E-768117IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MKRVEIVDRL SSLMSFSSSS LDNGEVVYSP SYSSFGDQAD QASLPAQQMS LMKPSATVRP  60
YLRSKMPRLR WSSDLHRCFV HAVERLGGED RATPKLILQI MNVKGLTISH VKSHLQMCRS  120
MKHEKRIQEA AIAAKRNDKA KLPDTSNSYL LHPTKSIATL PCCQRSNWMM RNMYNSAPYH  180
SNRSFYCIEG IDHNNTSTVA KWNNENCKQN SYFIFTDLVK RGSDNAQESN DQVKALSLVN  240
AGCHSTHNKL EDLATGAHID AAMSPSLKSS PKAYYSQQFR LRDAANSVVD DVSLELSLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-1668123459Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-1668123459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-1668123459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-1668123459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-1668123459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-1668123459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-1668123459Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-1668123459Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna19641.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004295277.10.0PREDICTED: putative Myb family transcription factor At1g14600
TrEMBLA0A2P6Q2J41e-156A0A2P6Q2J4_ROSCH; Putative transcription factor MYB-HB-like family
STRINGXP_004295277.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93812840
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.11e-31G2-like family protein