PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna19228.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB_related
Protein Properties Length: 386aa    MW: 43219.8 Da    PI: 7.1502
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna19228.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding414.5e-1370114147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              r +WT +E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  mrna19228.1-v1.0-hybrid  70 RESWTDQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 114
                              789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.5E-1664120IPR009057Homeodomain-like
PROSITE profilePS5129415.01465119IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-668120IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-1868117IPR006447Myb domain, plants
SMARTSM007171.4E-1069117IPR001005SANT/Myb domain
PfamPF002491.2E-1070114IPR001005SANT/Myb domain
CDDcd001677.49E-872115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MVSVNPNPAP QGFYLFDPTN MGLPGLNSMP PPTTPSTTST TMSSAAQNAA SLAEDQSKKI  60
RKPYTITKSR ESWTDQEHDK FLEALQLFDR DWKKIEAFVG SKTVIQIRSH AQKYFLKVQK  120
KGTSEHVPPP RPKRKATHPY PQKAPKSAPV VSQVVGPFES SSALLEHGYT YQPDSSFVHS  180
TPVTSATLSS WSHSYVPPVN ASQKTKDDGR LAGSADAQNS CYSSSNESKP TTWSMGETFG  240
RACHHQPQRV LPDFAQVYKF IGSVFDPDST CHLERLKQMD PINLETALLL MRNLSINLSS  300
PEFENHYGKD YEFEAPVELL DKMLHSLRQS PDEQLVVVSQ VLVFDINIWY EDIVNTQVLA  360
FNGKPVKNLK SLARLVENCE DEFLKI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5il9_A8e-27298385436523Protease Do-like 9
5il9_B8e-27298385436523Protease Do-like 9
5ilb_A7e-27298385344431Protease Do-like 2, chloroplastic,Protease Do-like 9
5ilb_B7e-27298385344431Protease Do-like 2, chloroplastic,Protease Do-like 9
5jyk_A8e-27298385436523Protease Do-like 9
5jyk_B8e-27298385436523Protease Do-like 9
5y09_A8e-27298385436523Protease Do-like 9
5y09_B8e-27298385436523Protease Do-like 9
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00423DAPTransfer from AT4G01280Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna19228.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004306739.10.0PREDICTED: protein REVEILLE 3-like
SwissprotC0SVG51e-100RVE5_ARATH; Protein REVEILLE 5
TrEMBLA0A2P6SHV10.0A0A2P6SHV1_ROSCH; Putative transcription factor MYB-HB-like family
STRINGXP_004306739.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01280.21e-101MYB_related family protein
Publications ? help Back to Top
  1. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]