PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna19130.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family HD-ZIP
Protein Properties Length: 830aa    MW: 89980.7 Da    PI: 6.3188
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna19130.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.63.2e-21131186156
                              TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                 Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                              +++ +++t++q++eLe+lF+++++p++++r eL+++l+L++rqVk+WFqNrR+++k
  mrna19130.1-v1.0-hybrid 131 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSRRLNLETRQVKFWFQNRRTQMK 186
                              688999***********************************************999 PP

2START208.82e-653355571206
                              HHHHHHHHHHHHHHHHC-TT-EEEE..EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.. CS
                    START   1 elaeeaaqelvkkalaeepgWvkss..esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla.. 77 
                              ela++a++elvk+a+ +ep+W+++   e++n +e++++f++  +     + +ea+r++g+v+ ++  lve+l+d++ +W e+++  
  mrna19130.1-v1.0-hybrid 335 ELALAAMDELVKLAQTDEPLWSLEGgrEILNHEEYMRSFTPCIGlkpngFVTEASRETGMVIINSLALVETLMDSN-RWLEMFPcm 419
                              5899********************999*************9999999*9***************************.********* PP

                              ..EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEE CS
                    START  78 ..kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgili 154
                                + +t++vissg      galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvSvd  ++++  + ++ +++lpSg+++
  mrna19130.1-v1.0-hybrid 420 iaRTSTTDVISSGmggtrnGALQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSVDTIRDNSGAPTFANCRRLPSGCVV 505
                              *********************************************************************9**************** PP

                              EEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                    START 155 epksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                              ++++ng+skvtwveh++++++++h l+r+l++sg+ +ga++wvatlqrqc++
  mrna19130.1-v1.0-hybrid 506 QDMPNGYSKVTWVEHAEYDESQVHHLYRPLLSSGMGFGAQRWVATLQRQCQC 557
                              **************************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-22117188IPR009057Homeodomain-like
SuperFamilySSF466892.17E-21117188IPR009057Homeodomain-like
PROSITE profilePS5007118.058128188IPR001356Homeobox domain
SMARTSM003893.6E-19129192IPR001356Homeobox domain
PfamPF000468.2E-19131186IPR001356Homeobox domain
CDDcd000861.20E-19131188No hitNo description
PROSITE patternPS000270163186IPR017970Homeobox, conserved site
PROSITE profilePS5084843.593326560IPR002913START domain
SuperFamilySSF559613.57E-33330557No hitNo description
CDDcd088751.01E-124332556No hitNo description
SMARTSM002344.8E-49335557IPR002913START domain
PfamPF018522.0E-57335557IPR002913START domain
SuperFamilySSF559616.26E-23586756No hitNo description
SuperFamilySSF559616.26E-23783823No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 830 aa     Download sequence    Send to blast
MSFGGFLDNS TGSSGGARIV ADIPYNHHPH HNANHTSMPS SAIAQPRLVT QSLTKSMFNN  60
SPGLSLALQT NADGGGDAAR MAENFEGNNN VGGRRSREEE NEISRSGSDN MDGAGSGDEG  120
DAADNSNPRK KKRYHRHTPQ QIQELEALFK ECPHPDEKQR LELSRRLNLE TRQVKFWFQN  180
RRTQMKTQLE RHENSLLRQE NDKLRAENMS IRDAMRNPIC TNCGGPAMIG DISIEEQHLR  240
IDNARLKDEL DRVCALAGKF LGRPISSLGP SMGPPLPSSA LELGVGNNGF GGMSSVSTSM  300
PLGPDFGAGL GGGMPLVAHT RPVAGGLDER TMFLELALAA MDELVKLAQT DEPLWSLEGG  360
REILNHEEYM RSFTPCIGLK PNGFVTEASR ETGMVIINSL ALVETLMDSN RWLEMFPCMI  420
ARTSTTDVIS SGMGGTRNGA LQLMHAELQV LSPLVPVREV NFLRFCKQHA EGVWAVVDVS  480
VDTIRDNSGA PTFANCRRLP SGCVVQDMPN GYSKVTWVEH AEYDESQVHH LYRPLLSSGM  540
GFGAQRWVAT LQRQCQCLAI LMSSTVPARD HANTITQSGR KSMLKLAQRM TDNFCAGVCA  600
STVHKWNKLN AGNVDEDVRY MTRESMDDPG EPPGIVLSAA TSVWLPVSPQ RLFNFLRDER  660
LRSEWDILSN GGPMQEMAHI AKGQDQGNCV SLLRARAMNA NQNSMLILQE TCIDAAGSLV  720
VYAPVDIPAM HVVMNGGDSA YVALLPSGFA IVPDGPGSRG PGGAEGKAGQ GSSNGNGGEA  780
RVSGSLLTMT FQILVNSLPS AKLTVESVET VNNLISCTVQ KIKGALQCES
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna19130.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004306832.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A2P6SGK80.0A0A2P6SGK8_ROSCH; Putative transcription factor & lipid binding Homobox-WOX family
STRINGXP_004306832.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]