PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna18585.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family Trihelix
Protein Properties Length: 595aa    MW: 67036.7 Da    PI: 5.9709
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna18585.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix89.53.6e-2853137187
                 trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                              rW++ e+laL+++r++m+ ++++++ k plWeevs+km e g++r +k+Ckek+en+ k++k+++e+++ r++++  t++yf+qle
  mrna18585.1-v1.0-hybrid  53 RWPRPETLALLKIRSDMDAEFKAASPKLPLWEEVSRKMGEAGYSRDAKKCKEKFENIYKYHKRTRESRGARSAGK--TYKYFEQLE 136
                              8********************************************************************986555..6*******8 PP

                 trihelix  87 a 87 
                              a
  mrna18585.1-v1.0-hybrid 137 A 137
                              5 PP

2trihelix90.12.4e-28386470186
                 trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                              rW+++ev +Li++r++ + +++++ +k++lWee+++ m++ g+ r++k+Ckekwen+nk+y+++k+++kkr +e+s+tc+y + l+
  mrna18585.1-v1.0-hybrid 386 RWPREEVSDLIRLRSNYDLQYQENGSKGHLWEEIAASMKKLGYDRNAKRCKEKWENINKYYRRLKDSNKKR-PEDSKTCAYVEMLD 470
                              8*********************************************************************8.99*******99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.1750112IPR001005SANT/Myb domain
PfamPF138376.6E-1752138No hitNo description
CDDcd122032.49E-2352117No hitNo description
PROSITE profilePS500906.4752110IPR017877Myb-like domain
PROSITE profilePS500907.933379443IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.5E-5383442IPR009057Homeodomain-like
SMARTSM007170.004383445IPR001005SANT/Myb domain
PfamPF138372.3E-20385472No hitNo description
CDDcd122031.20E-25386450No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 595 aa     Download sequence    Send to blast
MLENSTFPVN PSSPTTDRSA EEVAGDGGSV SVGLEEEERA GLEQGYRNWA GNRWPRPETL  60
ALLKIRSDMD AEFKAASPKL PLWEEVSRKM GEAGYSRDAK KCKEKFENIY KYHKRTRESR  120
GARSAGKTYK YFEQLEAIEQ HHSEHPPPAE TVQASTAETA AASPKDGVSN AIPCSSMQHQ  180
LSSFVDNSTP TTSCSSKESE GTHKKKRRVT EFFEKLMKQV IDKQENLQTK FVEVLDKYEQ  240
ERIAREEAWK MQELTRIERE RELLAQERSV AAAKDAAVLA FLQKFSEQAA SVNLPSQSCS  300
VQIPNQPSSV HLPLQACSVQ LPNQVSSAQL PVQASAVRVQ MPANSSVANT VSEKQKKDED  360
WELVRRSLES PDKNNGRSRT PTNSTRWPRE EVSDLIRLRS NYDLQYQENG SKGHLWEEIA  420
ASMKKLGYDR NAKRCKEKWE NINKYYRRLK DSNKKRPEDS KTCAYVEMLD SLYNKKNSKG  480
ENQADKNYDL RPEELLMHMM SGQEEQQQQP ESATQNGDSQ NVEKIQGDNG SIEGVGDVAG  540
DGYRIVAANP SPMEQDNPSV RIVFEVDLCG VTVRPICLFM KFTADDSEWV GATE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1203207KKKRR
2203208KKKRRV
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna18585.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004306599.10.0PREDICTED: trihelix transcription factor GT-2-like
TrEMBLA0A2H4NFW30.0A0A2H4NFW3_FRAAN; Trihelix transcription factor GT-2E
STRINGXP_004306599.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37334181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.11e-102Trihelix family protein