PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna18340.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 259aa    MW: 29055.9 Da    PI: 8.8106
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna18340.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65e-321468155
                  G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                             k+rlrWt+eLH+ Fv+av++LGG+++AtPk il++m+v gLt++h+kSHLQkYR+
  mrna18340.1-v1.0-hybrid 14 KERLRWTQELHDMFVDAVTKLGGPDRATPKGILKAMGVSGLTIYHIKSHLQKYRI 68
                             68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.4261171IPR017930Myb domain
SuperFamilySSF466892.15E-171368IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.4E-301369IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-261469IPR006447Myb domain, plants
PfamPF002491.9E-91667IPR001005SANT/Myb domain
PfamPF143792.7E-12101141IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MGSSKCLDAS AGNKERLRWT QELHDMFVDA VTKLGGPDRA TPKGILKAMG VSGLTIYHIK  60
SHLQKYRISK FVPETTSKAG NLQRKNISEI LPNFGTTSAA QLNEALHLMH IQVQRRLSDQ  120
LEVHKSLKQK FEAQGRFLDT ISADRSRNDN RLIITKPIKP MSRKTLPSLC EESELNGKEF  180
GTSDSDAEKT EIQSSGEEFQ ALKKQRVQNQ NEDNMAWNFH ILEDQTTNIS SYPAVYDQIS  240
FPWNNFGACT SPLVPSFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A7e-231471259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B7e-231471259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A9e-231471158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B9e-231471158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C9e-231471158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D9e-231471158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A7e-231471259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C7e-231471259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D7e-231471259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F7e-231471259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H7e-231471259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J7e-231471259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna18340.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024190972.11e-178myb family transcription factor PHL7-like
TrEMBLA0A498K6611e-103A0A498K661_MALDO; Uncharacterized protein
STRINGXP_008244092.11e-104(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF106592535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.14e-49G2-like family protein