PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna17777.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family VOZ
Protein Properties Length: 619aa    MW: 69512 Da    PI: 5.381
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna17777.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ355.91.7e-1093755844217
                      VOZ   4 saflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaataksp 89 
                                flgp calwdc+rpa+     +dyc +fhat al+eg+pg +pv+rp+gi++kd++lf+al a  qgk vgip+cegaa  ksp
  mrna17777.1-v1.0-hybrid 375 PPFLGPSCALWDCSRPAE---CGKDYCCNFHATSALEEGQPGKSPVFRPRGISVKDSALFDALIAWNQGKAVGIPNCEGAAILKSP 457
                              569*************96...5689************************************************************* PP

                      VOZ  90 wnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyein 175
                              wn ++lf+ls+lege++rewlffdkprraf sgnr+qrslpd+sgrgwhesrkq+mkef+g+krsyymdpqpss  +whl+eye+n
  mrna17777.1-v1.0-hybrid 458 WNDSKLFNLSFLEGEAVREWLFFDKPRRAFGSGNRRQRSLPDHSGRGWHESRKQIMKEFDGQKRSYYMDPQPSSDQDWHLFEYEVN 543
                              ************************************************************************************** PP

                      VOZ 176 eldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                              ++da+alyrlelk    k+s+kgkvs+  +adlqkk+g+lta
  mrna17777.1-v1.0-hybrid 544 NSDACALYRLELKFGSVKRSPKGKVSN-EVADLQKKMGKLTA 584
                              *************************86.59**********97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 619 aa     Download sequence    Send to blast
MEKIEKMESC WRCSYLLKLN SYLRKSSGNW IVTLLLHCGE VHLGSRSTWS QEGAQSDDVL  60
SDMSLPVSLF MEENIGFAWC KEAECWRFWL YKGPVALPRD KAVARRVSMT TEAQVLRRRW  120
NARDEAVASW ASLQGFAENP NISAFRSVAI VSGEDSEERK AMIKDSKGRC ESSSHKLVKE  180
KTKNRLDQLQ ALITKKNESQ TNDTATLVEV NKMLQEWKAE LNGPSPASSL LADSLGSFSE  240
ELTRLLRTDE EDDAISPLKE FLPAKPESDL QNLHLGNLMQ FTEDFYVSPE PQELQESFQD  300
FNYCKDTASG FQDFYQCNDT ASGFQNLMVD NSGFDNHFDF HQYVNEGPFI EGNDVKQLEE  360
DAVPNVLPVI SPTEPPFLGP SCALWDCSRP AECGKDYCCN FHATSALEEG QPGKSPVFRP  420
RGISVKDSAL FDALIAWNQG KAVGIPNCEG AAILKSPWND SKLFNLSFLE GEAVREWLFF  480
DKPRRAFGSG NRRQRSLPDH SGRGWHESRK QIMKEFDGQK RSYYMDPQPS SDQDWHLFEY  540
EVNNSDACAL YRLELKFGSV KRSPKGKVSN EVADLQKKMG KLTAEVATDG ATNVKGKAKK  600
KANAGNIFSS QSPMTSTP*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna17777.1-v1.0-hybrid
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1660925e-34AC166092.4 Glycine max cultivar Williams 82 clone gmw1-93l19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004303126.10.0PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ01e-127VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A2P6RUC90.0A0A2P6RUC9_ROSCH; Putative transcription factor VOZ family
STRINGXP_004303126.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-112vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]