PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna17756.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family HB-other
Protein Properties Length: 1696aa    MW: 191567 Da    PI: 6.2253
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna17756.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.52.3e-182076157
                             TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                 Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                             r kR   t++qle+Le++++ ++yps++ r+eL++kl+L++rq ++WF+ rR k++k
  mrna17756.1-v1.0-hybrid 20 RTKRKMKTRSQLEALEKAYAVEQYPSESVRAELSAKLDLSDRQLQMWFCHRRLKDRK 76
                             689****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.1E-18576IPR009057Homeodomain-like
SuperFamilySSF466891.2E-151476IPR009057Homeodomain-like
PROSITE profilePS5007116.5681777IPR001356Homeobox domain
SMARTSM003891.6E-161981IPR001356Homeobox domain
CDDcd000861.26E-132077No hitNo description
PfamPF000464.5E-162076IPR001356Homeobox domain
PfamPF050663.6E-15655723IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156124.0E-8872913IPR028942WHIM1 domain
PfamPF156136.0E-1110541130IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1696 aa     Download sequence    Send to blast
METGSEGEKT RAQAQAQEIR TKRKMKTRSQ LEALEKAYAV EQYPSESVRA ELSAKLDLSD  60
RQLQMWFCHR RLKDRKPTPA TGKRQRNDSL AEATGVVSEE GLQQSIIEAR AVAFVEAQLG  120
EPLREDGPIL GLEFDSLPPD AFGSSIGVAT VRQQKQSGWP CDANIHEQSN AKPIKGASRT  180
VHEYQFLPEK PTVRTDAYER AAPSHHYGSP TESRHPRIPL STVSSFIHGN EQVPTVYGFQ  240
SPMVGLNLLS QQGRAGHLLP SAAEEYGNVL GKNFTNVTMD SHFSTHLINQ LNNPLIPYAR  300
RVAHDEDDVL QLERKHKSEE ARIMREVEAH EKRIRKELEK QDILRRKREE QIRKEMERID  360
RERRKEEERI LREKQREEER YLREQRRELE RKERFLQKES IRAEKMRQKE ELRREKEAAR  420
LKAANERASA RKNAKESTEL IEDECLELME LAALSKGLPS MLSLDYETLQ NLESFRDMLS  480
TFPPKSVQLK KPFGIQPWMD SDENIGNLLM DSRLLGEIHI SLLRSIIKDI EDVARAPSMG  540
VGANQNCAAN PGGGHPQIVE GAYAWGFDIK SWKCNLNPLT WPEILRQFAV SAGFGPQLKK  600
RGVELAYRHE DNEVSDVKDI ISNLRSGVAV KNAFAIMQER GFSNPRKSRH RLTPGTVKFA  660
AFHVLSLEGS KGLTILEVAD RIQKSGLRDL TTSKTPEASI AAALSRDSKL FERTAPSTYC  720
VRAAYRKDTT DSKAVLSAAR ERIQNFRSKI FDVEGADEAE RDEESESDAV EDPEVDDLGT  780
EISSEIVAHR SEVAKKVGEK MSLESRKGRY EVNKAPGDVR NVTEGVPSIN SEAFIKVEDT  840
GSLNNSADAT GICTNVANHD QEDTEIDDSN PGEPWVQGLT EGEYSDLSVE ERLNALSALI  900
GVAIEGNSIR IVLEERLEAA NALKKQMWAV VQVDKRRFKD EHFIKMQYTP FSGNKTEQIP  960
TIHSSDERQS PSTVDEKNIE RTVKLSIPQD HIVDPQNEQN YINSFPSVGN LQMQENSVGP  1020
DNYPFQQPSL IADKSHKHLK YYIGHKAEEM YVYRSLPLGQ DRRHNRYWQF ITSASRNDPG  1080
CGRIFVELHD GRWRLIDSEE SGLWMQGFDG LLASLDVRGY RESHLQAMLQ MTEIFFKETV  1140
RRNMLHSNRR RHVKDTSKIE AVEMPSGYDC SGGTDSPTSS VSVADFDMLE SSMTFSIELG  1200
KDETEKTGAL NRYHDLEKWI WKECIGSSIL SADKNGKKRC PQLLDICNSC RGIFYFEENH  1260
CHSCHRTFGK GEVVFSQHVA LCKEKLNSNC SASSPLRMRL LKVLFALTEV YVPLEALQPL  1320
WTDMNRNSWG RKLHSSSSAE ELLQVLASLE SAIKTEYLSS NFETTSELLY CSNEKGCVTS  1380
NFSSPHRVSV LPWIPLTTAA VALRLMEFDA AISNMLQQKL ESHREKESGH FIKLPTRSAV  1440
MKSSQNKEKS GAPHQSEEFK EGQQEYLRSG LASPCHGLGC GQTRSGRVPK KAISLRGDPR  1500
KKSRVTSKDR LGQVHVLKWK GKPRAQGGRK RGNRSIRGNQ PTLNRIIQIG GERNSPKECV  1560
FYKPAENLGE ENWNEGETAA ENASGSGRTE YEEENGDASR DEFDHVNVDD YGRGFNGKSD  1620
DLLEGGDYNV EGYQDDVNED YDEGEAAQDT KGDPDYDGAR YINDEWDEEE CIADDGHQNR  1680
ILRNRNRSSS SDYSD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4574732e-35AM457473.2 Vitis vinifera contig VV78X112028.14, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011466929.10.0PREDICTED: uncharacterized protein LOC101301986 isoform X1
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLA0A067JX120.0A0A067JX12_JATCU; Uncharacterized protein
STRINGPOPTR_0017s04760.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25233369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator