PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna17750.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 586aa    MW: 64206.6 Da    PI: 6.8841
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna17750.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.41.4e-27195249156
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                              k +++WtpeLH+rFv+aveqL G +kA+P++ilelm++++Lt+++++SHLQkYR++
  mrna17750.1-v1.0-hybrid 195 KVKVDWTPELHRRFVQAVEQL-GVDKAVPSRILELMGIDCLTRHNIASHLQKYRSH 249
                              5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.152192251IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-26193252IPR009057Homeodomain-like
SuperFamilySSF466895.02E-18193252IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-26195249IPR006447Myb domain, plants
PfamPF002496.9E-8198247IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 586 aa     Download sequence    Send to blast
MLILSPLREQ HKDENRGGDQ MESFSIGTNV VDFSEFSGGN LLDSIDFDDL FIGIDSEMDV  60
LPDLEMDSEM LAEFSVSAGE ESDLNTSPAS LEKWDDEENK ASIKTSTAEE REDDHHQKVD  120
SSGSGTTDFK YSSSDNSSHG GGGGGGEEIV SKRDESAGGA VHNNTSSSPK ETTDKGHRKS  180
SSSSAQSKSS HGKRKVKVDW TPELHRRFVQ AVEQLGVDKA VPSRILELMG IDCLTRHNIA  240
SHLQKYRSHR KHLLAREAEA ASWTQRRQLY GSAAAAGGGG VGVKRPSSEI GPWLAPPTMG  300
FPPPMTPMHQ QPHHGHHHHH HHHHQFRPLH VWGHPTVDQS MMHMWPPKHL APFPSPQQQP  360
SWPPAPPPPP DTSYWHHHHQ RAPPNNAVLT PGTPCFPRQI ATSHTPPSTR FPVSPVPGIP  420
PHHGNMYKLD PAGLGVPGQS GPHPLVDFQP SKESIDAAIG DALSKPWLPL PLGLKPPSTD  480
SVMGELQRQG IPKNPVQHDR TKHVEVDHHF IKEKLDAKII SFPFVPTEEQ LAGADVRTAL  540
KVRTSLLSPP YGTGEGAPLP QRTPAASPTT FHLWRVRRIP VFQPD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-15192247257ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00022PBMTransfer from AT2G20570Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna17750.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0955031e-62BT095503.1 Soybean clone JCVI-FLGm-19O16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004303114.10.0PREDICTED: probable transcription factor GLK1 isoform X2
TrEMBLA0A2P6RTZ60.0A0A2P6RTZ6_ROSCH; Putative transcription factor MYB-HB-like family
STRINGXP_004303114.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42423461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.14e-72GBF's pro-rich region-interacting factor 1