PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna17673.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 321aa    MW: 34600.6 Da    PI: 7.1258
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna17673.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.61.9e-30109162155
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  mrna17673.1-v1.0-hybrid 109 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 162
                              59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.14E-20106166IPR009057Homeodomain-like
PROSITE profilePS5129411.059106165IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-30108167IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-24110162IPR006447Myb domain, plants
PfamPF002491.3E-7112161IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MREDDSNWFS RWEEQLPSPE ELMPLSQTLI SPDLALAFDI RSNPNPNTNT NANDSPQHTP  60
TPPPPPPPAS SLPPATPAHP NSSADFADSA DLGSGGGGPG DEPARTLKRP RLVWTPQLHK  120
RFVDAVAHLG IKNAVPKTIM QLMSVDGLTR ENVASHLQKY RLYLKRMQGL SAGVGAGAGG  180
GGSADPATDH LFASSPVPAH FLHPGRPNSD HFLPFVPVTI QHHHQQQQQH MTAAATHPQM  240
QQTPQYHHHR QPQVGHFGSP PNPNGQFEHP FLARQSQPVH RMGAPIHSPA VPGYIEDMES  300
ANATGATGRK VLTLFPTGDN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A2e-31109165157Transcription factor LUX
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a negative regulator of freezing tolerance via a CBF-independent pathway. {ECO:0000269|PubMed:20331973}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna17673.1-v1.0-hybrid
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by drought, salt and abscisic acid (ABA). Down-regulated by cold. {ECO:0000269|PubMed:20331973}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004303133.10.0PREDICTED: transcription factor PCL1
SwissprotO222105e-64MYBC1_ARATH; Transcription factor MYBC1
TrEMBLA0A059A3P31e-133A0A059A3P3_EUCGR; Uncharacterized protein
STRINGXP_004303133.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85423045
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.12e-87G2-like family protein
Publications ? help Back to Top
  1. Sardesai N,Laluk K,Mengiste T,Gelvin S
    The Arabidopsis Myb transcription factor MTF1 is a unidirectional regulator of susceptibility to Agrobacterium.
    Plant Signal Behav, 2018.
    [PMID:24785741]