PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna16679.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 590aa    MW: 66174.6 Da    PI: 4.9565
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna16679.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.81.2e-33218272155
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              k+r+rWt+eLHe+Fveav+qLGGs++AtPk il++mkv+gLt++hvkSHLQkYR+
  mrna16679.1-v1.0-hybrid 218 KARMRWTQELHEAFVEAVNQLGGSDRATPKGILNVMKVEGLTIYHVKSHLQKYRT 272
                              68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.142215275IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-31216273IPR009057Homeodomain-like
SuperFamilySSF466891.04E-17216272IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-25218273IPR006447Myb domain, plants
PfamPF002492.5E-9220271IPR001005SANT/Myb domain
PfamPF143793.6E-18304351IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
SuperFamilySSF542366.66E-7425494IPR029071Ubiquitin-related domain
Gene3DG3DSA:3.10.20.909.1E-5426482No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 590 aa     Download sequence    Send to blast
MSSAFPNLPT PLDVSYSRLP DSFHRSAQRE NPMHSLLPQP SSLGNSYSSS SSLPFDSQFS  60
SVYPHERYPQ NSPISMSPSG GKSLSHTHSE LQSTPVASYP EENKDMSWCP DSIEEFLHFP  120
ENVPDQNGLV DTSTGAIISD DHAERTDWSD LYPLISFDGA LDSNWELSVD NVVDPKPEVL  180
NHSSDILVQQ PNIQQHQPAQ SGEIFTSPDP ESTAPSTKAR MRWTQELHEA FVEAVNQLGG  240
SDRATPKGIL NVMKVEGLTI YHVKSHLQKY RTAKYKPESS EGACEKNLTP VEEMNSKDLK  300
TSSMGMTEAL RLQVELQKQL HEQLETQRKL QLQIEEQAKY LEKMFEQQRK MEDNKVKPTS  360
STSDERNKIG TSTPMDEGSQ DASLKQNAQE PATHENHDPP GDADSELIFI QFKDVPVAYS  420
VELGSKDETV NDIKEKIKKE YPDGRHLKPQ ETLVYKNQEL KGGDLITEYH LPKNTLLHVA  480
ERNAVAAPMS PKNVKEKEEE GPWDLGGVQS VKQGQLQPVD LLTMDEPFYN NPILKPKEMY  540
ANRSSSPPAP NLNGLRRKMV VEDETTRVCD KRARISTLPN ETTRVCDRN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-29218276260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-29218276260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-29218276260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-29218276260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-29218276260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-29218276260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-29218276260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-29218276260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna16679.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004302103.10.0PREDICTED: protein PHR1-LIKE 1 isoform X1
TrEMBLA0A2P6R5H50.0A0A2P6R5H5_ROSCH; Putative transcription factor MYB-HB-like family
STRINGXP_004302103.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15123498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04450.22e-69G2-like family protein