PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna16561.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family bZIP
Protein Properties Length: 427aa    MW: 46739.1 Da    PI: 4.9577
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna16561.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.32.2e-15228283358
                              XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                              ++kr rr+ +NRe+ArrsR+RK+a + eLe+ +++L  eN++L k+l  +++++ +
  mrna16561.1-v1.0-hybrid 228 DVKRVRRMLSNRESARRSRRRKQAHLTELETQAAQLRVENSSLLKRLTDMNQKYNE 283
                              579**************************************999888777777665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.7E-19226290IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.381228283IPR004827Basic-leucine zipper domain
PfamPF001706.7E-13229282IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.19E-11230281No hitNo description
Gene3DG3DSA:1.20.5.1709.4E-12230282No hitNo description
PROSITE patternPS000360233248IPR004827Basic-leucine zipper domain
PfamPF124985.4E-43297424IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071215Biological Processcellular response to abscisic acid stimulus
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MDRVFSSMEE ISDHLWSSSG KNEDEDEDEL SKMNRSTSEW SFQRFLQQQQ GSVSPSSSSQ  60
QQQQEAQNNE VEEIKVNATS MAFPNGPNHS NTSSSAASFK PPNVPVDSEE YQAFLKTKLD  120
LACAAVALSR VKGSLVKAQD SSLADSGQQA SDDLQLGSQA SSQGAGNDLC RSYDKNTNAP  180
FGIPALPTIR NRSAVPIRQA TSGSSRELSD DEEVEGETAM TENMDPTDVK RVRRMLSNRE  240
SARRSRRRKQ AHLTELETQA AQLRVENSSL LKRLTDMNQK YNEAAVDNRV LKADMETLRA  300
KVKMAEETVK RLTGSNPLFH TTSDVSSISM APFDGSPSET STDAAVPVQD DPNHHYFQPS  360
SNNSMPTHDF RGNNGLADNT PSVENAQQTS AATSTEVAGN KMGQTPSLQR VDSLERLQKR  420
IRGGEQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1242249RRSRRRKQ
2244249SRRRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00040PBMTransfer from AT5G28770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004302051.10.0PREDICTED: light-inducible protein CPRF2
SwissprotQ990901e-121CPRF2_PETCR; Light-inducible protein CPRF2
TrEMBLM5VZ410.0M5VZ41_PRUPE; Uncharacterized protein
STRINGPGSC0003DMT4000500961e-146(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41763358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.21e-76bZIP family protein