PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna15767.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 432aa    MW: 48236.9 Da    PI: 9.5008
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna15767.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.93.6e-3190143255
                  G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              prlrWtp+LH +F++ave+LGG+e+AtPk +l+lm+v gL+++hvkSHLQ+YR+
  mrna15767.1-v1.0-hybrid  90 PRLRWTPDLHLAFIHAVERLGGQERATPKLVLQLMNVRGLSIAHVKSHLQMYRS 143
                              8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.72786146IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.6E-2986144IPR009057Homeodomain-like
SuperFamilySSF466895.2E-1488144IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-2290145IPR006447Myb domain, plants
PfamPF002495.2E-991142IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MGDPEMIEIS DEADDNQSTS DGSKDIRSKS SSPKASCLFL DLNAEASSDD HENASNNVKA  60
GGSRISTEGK EQTATSNSGA VRQYVRSKMP RLRWTPDLHL AFIHAVERLG GQERATPKLV  120
LQLMNVRGLS IAHVKSHLQM YRSKKLDESG QVLPQFHRSR GILLQGRDQV VEAYQQFNPY  180
SRHFRFHGRG SQFPSPPSKH HPYDNLNANC SRLISQWSNP GMENNRSINT ITSSHIISVN  240
EAMTRVHAPI RPSRFLEDKR WPPREMIGNH NKGMRHSLNI SWGNTIHVAQ PKSVGSPQAS  300
SNQHLPTNTT TCSPKFISSI YEPLSDPLEV RKPDESINGE TYRAEVGDNM QATKQKKWLP  360
LNLQLSLRQD FSICSDEMKD GEQESMKDIE TTLSLSLSSS SPRRQQDQSS TPTSRVRLLS  420
SFPLSGSLKP T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A5e-1891145357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-1891145357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-1891145357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-1891145357Protein PHOSPHATE STARVATION RESPONSE 1
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna15767.1-v1.0-hybrid
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT8934069e-75KT893406.1 Prunus persica cultivar Xiaobaitao putative Myb family transcription factor mRNA, partial cds.
GenBankKT8934079e-75KT893407.1 Prunus persica cultivar Jinliuzaohong putative Myb family transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004305446.10.0PREDICTED: probable transcription factor GLK1
TrEMBLA0A314ZD531e-132A0A314ZD53_PRUYE; Uncharacterized protein
STRINGXP_004305446.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30123270
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-36G2-like family protein