PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna15385.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family Trihelix
Protein Properties Length: 563aa    MW: 63945.8 Da    PI: 6.1606
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna15385.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix98.84.6e-31370454186
                 trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                              rW+++ev aLi +r+++e ++++   k+plWe+vs+ m++ g++rs k+Ckekwen+nk+++k+k++ kkr s++s+tc+yf+ql+
  mrna15385.1-v1.0-hybrid 370 RWPQSEVEALILVRSNIEPKFQEPGHKGPLWEQVSASMASLGYQRSGKRCKEKWENINKYFRKTKDSPKKR-SQQSKTCSYFNQLD 454
                              8*********************************************************************8.78889********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.911363427IPR017877Myb-like domain
CDDcd122034.55E-26369434No hitNo description
PfamPF138375.5E-21369456No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MQSNFETADL PSQQHFMDTN SSSPVFFNPQ NQTHPSFHQQ QLSHHLVHPI PITHELFQGL  60
HPQPEQEHQS GTAHWQMSPL NFKLGLNENS ASGQAALLDQ NNPLFLQSRQ QNLGFKSWQP  120
QEFSTRKEPF WKPNETEGMN QKQEIQGEMC KELEGKYRLY GELEAIYSLA KIGDVNNRQT  180
GSGSALTNEN SPKNVDLVTP VPFGGSHGLN AVPAAIDGVD DGSEASIEEE VSYRNVQKRK  240
RKRRMKEQMS SSTARFFEGL VKRVMDHQES LHNRYLALIE KMDRERRERE AAWRMQEAEK  300
HKRAAIAQLH EQALASKRES LILSYIEKIT GRKVNIPCRE IPSLLQCDYS NGAREGELTP  360
AKADHETNSR WPQSEVEALI LVRSNIEPKF QEPGHKGPLW EQVSASMASL GYQRSGKRCK  420
EKWENINKYF RKTKDSPKKR SQQSKTCSYF NQLDQLYSRT PITNPPSSSY CSSNPAVSIE  480
RQGYSELLQA VITGSDTGVS ENLSSGNFEL LSEMGSNRLD FDGFTNGKVE HLRENHGREM  540
ENHEDDGSME EEEDIHGDDS DE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1237243KRKRKRR
2237244KRKRKRRM
3238243RKRKRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00651PBMTransfer from LOC_Os02g01380Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna15385.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011467225.10.0PREDICTED: trihelix transcription factor GT-2-like
TrEMBLA0A2P6Q1N00.0A0A2P6Q1N0_ROSCH; Putative transcription factor MYB family
STRINGXP_004305610.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF139981421
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.12e-38Trihelix family protein