PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna15055.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 1108aa    MW: 124229 Da    PI: 9.0886
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna15055.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.83.7e-31130183255
                  G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  mrna15055.1-v1.0-hybrid 130 PRMRWTTTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 183
                              8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.85E-15127184IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-27128184IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-22130183IPR006447Myb domain, plants
PfamPF002491.0E-6131182IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.630.102.2E-9313516IPR001128Cytochrome P450
SuperFamilySSF482643.67E-17380561IPR001128Cytochrome P450
PfamPF000674.8E-15652715IPR001128Cytochrome P450
SuperFamilySSF482642.6E-19652716IPR001128Cytochrome P450
Gene3DG3DSA:1.10.630.101.0E-19652716IPR001128Cytochrome P450
SuperFamilySSF482643.67E-17674716IPR001128Cytochrome P450
SMARTSM005977.1E-13779872IPR006580Zinc finger, TTF-type
PfamPF142911.0E-63839985IPR025398Domain of unknown function DUF4371
PfamPF056991.5E-610131083IPR008906HAT, C-terminal dimerisation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0055114Biological Processoxidation-reduction process
GO:0003677Molecular FunctionDNA binding
GO:0005506Molecular Functioniron ion binding
GO:0016705Molecular Functionoxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0020037Molecular Functionheme binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 1108 aa     Download sequence    Send to blast
MRSTSSPLPD LSLQISPPSD HYEIALSRKA LNGDRSSTTD SASSGSDLSH ENVLYHLDQR  60
TSYNPAAAEP GPNLSLGLEM KDIISNSTSS TPLPPRNFNH HHHHHPQIYG REFKRSARTV  120
GNVKRSVRAP RMRWTTTLHA HFVHAVQLLG GHERATPKSV LELMNVKDLT LAHVKSHLQM  180
YRTVKSTDHK GTGHEGQLMD MGLDQNPGNN NVQVNGSALP CDSEKAIDSP STLLLQNPSI  240
RGSWHSTRKT NGSCKPSPGD FLTCSDSPSS IGTKVDEEDS GSGRQLDCSS LSSSDHMYLN  300
LEFTLGRPRR MATHRPPPPS RWRRSASLPH IRCNGRQIRP SFQHQSRQPP CFRSEQLGSS  360
QRLLHHKRQG ARLTSDHGGR GYNYAVFGFA PYSTFWREMR KIATLELLSN GRLEMLKHVR  420
ISEVDMGIRE FHGLWVEKGS CTPVLVEMKH WLEELTLNVV VRMVAGKRYF GSSAAACDEE  480
EAGLCQKAIS QFFHLIGIFG HEKAMKKTAK DLDQILGGNK GNSPIFNMIQ IPVSSLPVWQ  540
LSILGGSDKT AETLTWVISL EKFLGATAAP PDTCAPNHAY FLLPFSGEAS SSFLFDAAEG  600
PCGFSEGHIT PAASPAWRRA WTNPCKSRRG RKKKNREEGR KKKRKEGRRR VAQEELDLHV  660
GTDRLVDESD IKNLVYLQAI IKETLRLYPA GPLLGLREAL EDCTVAGYHV PAGNRLVNER  720
SKQSRVEINL GELPSDPGLR MKISDYHHDV RDKIRREYML RGPCQPSNHV FVQTQRGAGK  780
QSFCVDWFDE FSNWLEYSIS KDAAFCLCCY LFKPNVGEQG GGDCFSGIGF RNFKKKDRLQ  840
GLAFRGHDES ENSSNQGNFL ELLQFLADHN DEVRAVALKN APENLKLTSP RVQKDIVNAA  900
AVETTNVIIK DIGDAFFSIL VDESRDVSVK EQMTIIFRYV DKNGCVIESF IGIEYVKSTT  960
AMSLKKAIDA LFSKHGLSIT RLRGQELLFL EIQLETYIDD MRSNDKFQEL QGIADLTKKL  1020
VETRKHKTYP YVYLLITLAL VLPVATASVE RAFSAMNIIK NRIRNRMGDQ WMNDSLAVYL  1080
EKDIFISIDN ESIIQRFQNM APRRGQL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-16131185357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-16131185357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-16131185357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-16131185357Protein PHOSPHATE STARVATION RESPONSE 1
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1628641RGRKKKNREEGRKK
2630641RKKKNREEGRKK
3630644RKKKNREEGRKKKRK
4639645RKKKRKE
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna15055.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2834731e-91KP283473.1 Prunus incisa isolate 462-2010A aberrant testa shape (ATS) gene, complete cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44633358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.16e-49G2-like family protein