PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna15029.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family ARR-B
Protein Properties Length: 644aa    MW: 71022.7 Da    PI: 6.2045
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna15029.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like83.91.6e-26201254155
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              kpr++W+ +LH++Fv av++L G++kA+Pk+il+lm+ + Lt+e+v+SHLQk+Rl
  mrna15029.1-v1.0-hybrid 201 KPRVVWSVDLHRKFVAAVNKL-GIDKAVPKKILDLMNEDKLTRENVASHLQKFRL 254
                              79*******************.********************************8 PP

2Response_reg78.91.7e-26201281109
                              EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHH CS
             Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeee 84 
                              vlivdD+ + +++l+++l k +y +v++++++  alell+ ++  +Dl++ D++mp+mdG++ll+     e++lp+i+++++g+ e
  mrna15029.1-v1.0-hybrid  20 VLIVDDDVTCLRVLETMLYKCQY-HVTATSHAFTALELLRGNKnkFDLVISDVQMPDMDGFKLLELVGL-EMDLPVIMLSSNGDHE 103
                              8**********************.***************555555*******************87754.558************* PP

                              HHHHHHHTTESEEEESS--HHHHHH CS
             Response_reg  85 dalealkaGakdflsKpfdpeelvk 109
                              ++ + +  Ga d+l+Kp+ ++el +
  mrna15029.1-v1.0-hybrid 104 LVMKGVTHGACDYLVKPVRIQELKN 128
                              **********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363923.6E-1561642IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23002.5E-4117151No hitNo description
SuperFamilySSF521721.99E-3517138IPR011006CheY-like superfamily
SMARTSM004481.1E-3118130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.0819134IPR001789Signal transduction response regulator, receiver domain
PfamPF000729.7E-2420128IPR001789Signal transduction response regulator, receiver domain
CDDcd001569.57E-2721134No hitNo description
PROSITE profilePS5129410.828198257IPR017930Myb domain
SuperFamilySSF466893.94E-18198258IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.5E-28199259IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-24201254IPR006447Myb domain, plants
PfamPF002492.0E-5203252IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 644 aa     Download sequence    Send to blast
MTIEPLFDDQ RDQFPIGMRV LIVDDDVTCL RVLETMLYKC QYHVTATSHA FTALELLRGN  60
KNKFDLVISD VQMPDMDGFK LLELVGLEMD LPVIMLSSNG DHELVMKGVT HGACDYLVKP  120
VRIQELKNIW QHVIRRKKGD SKDQTNSGNQ DKSHIGSCGG GMGNSDQNVK LTKKRKDQDE  180
DEDDNRDEDG YDNDDPSTQK KPRVVWSVDL HRKFVAAVNK LGIDKAVPKK ILDLMNEDKL  240
TRENVASHLQ KFRLYLKRIS CVANQQANMM AAIGSSDSSY LRMSTFNGGR NYHALTGPGQ  300
FNNTGFRSMP LNGMIGRVNA PAGLGLHCLP SSGSIKLGQG QHSSNSILDQ SIFPGNRNGS  360
MLQGNLELDQ RHSKGVNGTP VFPISSGFPD AKLTMSRSSD SVGLTDNPIL SHPRDFEGGR  420
EYVNQSSLPV APLKTEFCAP FLDHGRLNDS WASAAQSSAF RSNSFPSSNT RDSIPVVMSS  480
QMRNCQFDAP INSVSSHLQD PGTDVLIQPS AISSTAGQII DSDPTQGWVW MDHKQDSPYY  540
HSDTVSSSMD SLMPANVPVA FDHNLDSKGT TLQRNMDFNS IGQSNFLDPL HTKFDEIDRS  600
LEASMNINLK PGYVMDQRKP QGGVVSNNYG LLDDLVSTMT NQV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-26197260164ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna15029.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004291944.10.0PREDICTED: two-component response regulator ARR12
SwissprotQ6H8051e-130ORR24_ORYSJ; Two-component response regulator ORR24
TrEMBLA0A2P6PY980.0A0A2P6PY98_ROSCH; Two-component response regulator
STRINGXP_004291944.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-121response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]