PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna14942.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family bZIP
Protein Properties Length: 158aa    MW: 17845 Da    PI: 4.6758
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna14942.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.72.4e-133191363
                             XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                             +l++ +r+ +NRe+ArrsR RK++ +  L+  v  L +eN +    ++  ++++ +l++e+
  mrna14942.1-v1.0-hybrid 31 DLRKRKRMVSNRESARRSRMRKQEHLTDLTAQVGLLRKENNQILTSINVTNQLYLNLEAEN 91
                             58999*******************************************9999999999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.3E-132993IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.9333178IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.62E-123287No hitNo description
PfamPF001702.7E-103290IPR004827Basic-leucine zipper domain
CDDcd147022.03E-173484No hitNo description
Gene3DG3DSA:1.20.5.1701.2E-934108No hitNo description
PROSITE patternPS0003603651IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MATSSGNSSG SSALQIMNSG SDQEGLHQVM DLRKRKRMVS NRESARRSRM RKQEHLTDLT  60
AQVGLLRKEN NQILTSINVT NQLYLNLEAE NCVLRAQVAE LTNRLQSLND IVDCIDSTKW  120
LLDNEEEEDM TAQFGGDEFL NPWSNLCFNQ PVDMFMC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14552RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004287866.11e-113PREDICTED: ocs element-binding factor 1-like
TrEMBLM5VSC47e-74M5VSC4_PRUPE; Uncharacterized protein
STRINGPOPTR_0005s25290.11e-48(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61334147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.12e-40basic leucine-zipper 44