PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna14891.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family GATA
Protein Properties Length: 433aa    MW: 47567.5 Da    PI: 7.6119
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna14891.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.44.8e-19245279135
                     GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                              Cs+Cg+ kTp+WR gp+g ktLCnaCG++y++ +l
  mrna14891.1-v1.0-hybrid 245 CSHCGVQKTPQWRTGPNGAKTLCNACGVRYKSGRL 279
                              *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.426239275IPR000679Zinc finger, GATA-type
SMARTSM004015.5E-17239293IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.61E-14240301No hitNo description
Gene3DG3DSA:3.30.50.103.8E-15243277IPR013088Zinc finger, NHR/GATA-type
CDDcd002025.24E-14244292No hitNo description
PROSITE patternPS003440245270IPR000679Zinc finger, GATA-type
PfamPF003205.0E-17245279IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MECVALKTSI RTEMAVKEAV FDDLLWGLNA QNGGVQNCED FSVDDLLDFS NDDGFVEQEE  60
QEDDKKDSVL PKKESTVEEK ENSTPSSCVS EKNELGPEPA EPTSELTVPA DDLENLEWLS  120
HFVEDSFSGF NASLPAGFMA VKPEKRPEPE ALKPCFKTPV PAKARSKRTR TGGRVWSLGS  180
PSFTETSSSS SSSSSTSSCP SSPWLIYNPT QGLGGFGSSV EKPQKKPKRP ATTEGGGSSQ  240
PPRRCSHCGV QKTPQWRTGP NGAKTLCNAC GVRYKSGRLV PEYRPACSPT FSSELHSNHH  300
RKVMEIRRKK EGPAGPEPGL MTTAAATLVV RISFRGKGGF GGLSNWFFWV SEFETVHPFF  360
LTVAVGKHKC YEPRAKRHGF LWRMMHAVSC RILTIRGRCP IRGDWTAEDE GREMHYLQIP  420
GGGFWGSWFS GC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004287842.20.0PREDICTED: GATA transcription factor 5-like
SwissprotQ9FH572e-73GATA5_ARATH; GATA transcription factor 5
TrEMBLM5WGI31e-138M5WGI3_PRUPE; Uncharacterized protein
STRINGVIT_04s0023g02880.t018e-94(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.26e-72GATA transcription factor 5