PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna14133.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family WOX
Protein Properties Length: 269aa    MW: 29610.3 Da    PI: 7.7781
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna14133.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.71.2e-192282257
                             T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                 Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                              +R+++tkeq+++Le+l+ek  r+psae ++  +++l    +++ ++V++WFqN++a++++
  mrna14133.1-v1.0-hybrid 22 TTRWNPTKEQITILEDLYEKgMRTPSAEFIQAVTARLktygHIEGKNVFYWFQNHKARQRQ 82
                             58*****************99**************************************96 PP

2Wus_type_Homeobox112.42.4e-362183264
        Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                             ++tRW+Pt+eQi+iLe+ly++G+rtP++e iq +ta+L++yG+ie+kNVfyWFQN+kaR+rqk
  mrna14133.1-v1.0-hybrid 21 NTTRWNPTKEQITILEDLYEKGMRTPSAEFIQAVTARLKTYGHIEGKNVFYWFQNHKARQRQK 83
                             689***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.2361883IPR001356Homeobox domain
SMARTSM003893.9E-42087IPR001356Homeobox domain
SuperFamilySSF466891.8E-112288IPR009057Homeodomain-like
CDDcd000863.35E-52384No hitNo description
PfamPF000462.8E-172382IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.3E-72382IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MEGEDQQVKK GGSALGVGLE NTTRWNPTKE QITILEDLYE KGMRTPSAEF IQAVTARLKT  60
YGHIEGKNVF YWFQNHKARQ RQKEKQEASL AYFNRFLHTA AVSQYPLFPP PPQYPCSNVI  120
CSPYYMPPVP SEVGLCPQSH PMVPPQSVGV KRRPRMEKLD VPTRTCSNGG GGFEPMRHGY  180
GRGGRCSVDL NDGTNRFMSN SDDPETLPLF PLTPTGLLQG RDESLLSSLA GNCAQNSTAL  240
VSSSGIVEGH GERPSFYDFF SGGQGRCE*
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna14133.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004295925.10.0PREDICTED: WUSCHEL-related homeobox 2
TrEMBLA0A2P6QII21e-144A0A2P6QII2_ROSCH; Putative transcription factor Homobox-WOX family
STRINGXP_004295925.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.13e-41WUSCHEL related homeobox 2