PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna14025.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family WOX
Protein Properties Length: 256aa    MW: 28948.7 Da    PI: 8.3812
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna14025.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.41.6e-201776357
                             --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                 Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                             +R+++t+eql +Lee+++   r+p+a+++++++++l    +++ ++V++WFqN++a++++
  mrna14025.1-v1.0-hybrid 17 SRWCPTPEQLMILEEMYRAgVRTPNASQIQHITTQLsyygKIEGKNVFYWFQNHKARDRQ 76
                             8*****************99*************************************996 PP

2Wus_type_Homeobox119.81.2e-381577264
        Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                             +++RW+PtpeQ++iLee+y++G+rtPn+++iq+it++L+ yGkie+kNVfyWFQN+kaR+rqk
  mrna14025.1-v1.0-hybrid 15 SSSRWCPTPEQLMILEEMYRAGVRTPNASQIQHITTQLSYYGKIEGKNVFYWFQNHKARDRQK 77
                             689***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.4141277IPR001356Homeobox domain
SMARTSM003891.4E-51481IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.0E-81776IPR009057Homeodomain-like
PfamPF000463.8E-181776IPR001356Homeobox domain
SuperFamilySSF466898.98E-121777IPR009057Homeodomain-like
CDDcd000865.40E-51877No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009908Biological Processflower development
GO:0009943Biological Processadaxial/abaxial axis specification
GO:0009947Biological Processcentrolateral axis specification
GO:0010865Biological Processstipule development
GO:0048513Biological Processanimal organ development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MPPAANFSAS SSSASSSRWC PTPEQLMILE EMYRAGVRTP NASQIQHITT QLSYYGKIEG  60
KNVFYWFQNH KARDRQKLRR KLCKQLHLQQ QQLYHNYYHS QHHHPQQLML NQQSLLGYLD  120
QSPPASSVLH QLPLCCHHHN LFSGTGFLPQ VGVEDALMNF TRKVHEIPSA TAERSEMEKS  180
VINMYGHDWM TTTTATMDLA PSSSPACCIR SATATPPRPL KTLQLFPIKS SSLRAEDHEE  240
GEESTSSPSN PRNYI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna14025.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004295961.10.0PREDICTED: WUSCHEL-related homeobox 3-like
TrEMBLA0A2P6QI451e-130A0A2P6QI45_ROSCH; Putative transcription factor Homobox-WOX family
STRINGXP_004295961.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF106322940
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.11e-32WOX family protein