PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna13545.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 291aa    MW: 33012 Da    PI: 8.426
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna13545.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.92.3e-332680155
                  G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                             kprlrWtp+LH+rFv+av++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  mrna13545.1-v1.0-hybrid 26 KPRLRWTPDLHDRFVDAVTKLGGPDKATPKSVLRLMGLKGLTLYHLKSHLQKYRL 80
                             79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.912383IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-322381IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-242681IPR006447Myb domain, plants
SuperFamilySSF466891.63E-162683IPR009057Homeodomain-like
PfamPF002493.0E-92879IPR001005SANT/Myb domain
PfamPF143794.3E-22132177IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MSYNYGGNGE ESCPYENGVM MTRDPKPRLR WTPDLHDRFV DAVTKLGGPD KATPKSVLRL  60
MGLKGLTLYH LKSHLQKYRL GQQTRKQNSS EQGRENNGDS FVHFSNHHST ESTTKSSRGN  120
SEQGKTQNRT IPLSEAIKCQ IEVQNKLQEQ LEVQKKLQMR IEAQGKYLQA ILEKAQKGLS  180
VDMKGPITAE TTRAQLTDFN LALSNFMENM SEEERRVSML EMNEAYKKSN GPTFQIYEEG  240
NIAEENKDSK LKVERGSIHF DLNTKGSYDY VGSNGNEFEP RCFRLQDSSL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-192679154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-192679154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-192679154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-192679154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna13545.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011465067.10.0PREDICTED: myb family transcription factor APL
SwissprotC0SVS49e-86PHLB_ARATH; Myb family transcription factor PHL11
TrEMBLA0A2P6PAV40.0A0A2P6PAV4_ROSCH; Putative sterol 14-alpha-demethylase transcription factor MYB-HB-like family
STRINGXP_004301640.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51013142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.11e-74G2-like family protein
Publications ? help Back to Top
  1. Petridis A,Döll S,Nichelmann L,Bilger W,Mock HP
    Arabidopsis thaliana G2-LIKE FLAVONOID REGULATOR and BRASSINOSTEROID ENHANCED EXPRESSION1 are low-temperature regulators of flavonoid accumulation.
    New Phytol., 2016. 211(3): p. 912-25
    [PMID:27125220]