PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna13487.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family G2-like
Protein Properties Length: 353aa    MW: 39270.5 Da    PI: 8.4565
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna13487.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1031.8e-3270123255
                  G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              prlrWtp+LH rFv+ave+LGG+++AtPk +l+lm++kgL+++hvkSHLQ+YR+
  mrna13487.1-v1.0-hybrid  70 PRLRWTPDLHLRFVHAVERLGGQDRATPKMVLQLMNIKGLSIAHVKSHLQMYRS 123
                              8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-3066124IPR009057Homeodomain-like
PROSITE profilePS5129412.72866126IPR017930Myb domain
SuperFamilySSF466895.73E-1568124IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-2370125IPR006447Myb domain, plants
PfamPF002491.2E-871122IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MDGMSGESEC SKTSPSDDRN EEGSSESGEN YDGEINKPKN NGGSSSNSTV EESGDQKKGS  60
VRPYVRSKMP RLRWTPDLHL RFVHAVERLG GQDRATPKMV LQLMNIKGLS IAHVKSHLQM  120
YRSKKIDDAG QVIGDQGHHL VECGDKNIYN LSQLPMLQGY NRSHMSTSFR YGYGDSNSWS  180
TSAYENLRHP RSTSGIFQGT IAEKLFGSST SNWNSTAYSN FRTSSEQGPS WITHTLKDEC  240
SQLYNIRRQS LQAHQARLSI IDHLNPTMHV QPKAKDHFTS LSSTATNLQD LKTLKRKASD  300
CDLDLDLSLR LTTKNNDESP RSTTLKDNEV DCTSLSLSLY SPASAKLSRV KE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-1771125458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-1771125458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-1771125357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-1771125357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-1771125357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-1771125357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-1771125458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-1771125458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-1771125458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-1771125458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-1771125458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-1771125458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna13487.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004302585.10.0PREDICTED: probable transcription factor KAN2
TrEMBLA0A2P6R8W90.0A0A2P6R8W9_ROSCH; Putative transcription factor MYB-HB-like family
STRINGXP_004302585.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23783482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.19e-59G2-like family protein