PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna13452.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family Trihelix
Protein Properties Length: 316aa    MW: 36964.4 Da    PI: 6.8514
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna13452.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix81.11.5e-2563144185
                 trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdql 85 
                              +W+ qe+++Li++r e+++++ ++k++k+lWe ++ +m+++g +rs++qCk+kw+nl +ryk +++ e +     ++++p+f++l
  mrna13452.1-v1.0-hybrid  63 QWSLQETKELITIRAELDQTFMETKRNKQLWEVIATQMKDKGHNRSAEQCKCKWKNLVTRYKGCETAEAET---MRQQFPFFNDL 144
                              7********************************************************************84...55679****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.5E-460122IPR001005SANT/Myb domain
SuperFamilySSF466897.26E-562126IPR009057Homeodomain-like
CDDcd122033.90E-2462127No hitNo description
PfamPF138375.3E-2063145No hitNo description
Gene3DG3DSA:1.10.10.601.3E-463119IPR009057Homeodomain-like
PROSITE profilePS500908.0664120IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0016592Cellular Componentmediator complex
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MDGHYPHHLH HQQQQELHQF QLQHQFQVVQ QPQQLLPPPP HQHRHLSPPP ITVHVDASDR  60
FPQWSLQETK ELITIRAELD QTFMETKRNK QLWEVIATQM KDKGHNRSAE QCKCKWKNLV  120
TRYKGCETAE AETMRQQFPF FNDLATIMVA REQRLPWTEA DGNGGASGSK KKAAAVAVSS  180
DEDDEDHEDS EEAGEKGITS ARKKKKVMKT GNIGSSSTGM GLGGNNVKEI LEDFMRQQLQ  240
LDMQWRDEFQ ARENERRMRE YEWRQTMEAI ENERLMAERE WREREERRRM REEARAEKRD  300
AILTALLDRL NRGGM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004302587.10.0PREDICTED: trihelix transcription factor GT-3b
RefseqXP_011466470.10.0PREDICTED: trihelix transcription factor GT-3b
SwissprotO804501e-65TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLB9HCX71e-97B9HCX7_POPTR; Uncharacterized protein
STRINGPOPTR_0006s10240.13e-97(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.13e-58Trihelix family protein