PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna13363.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family Trihelix
Protein Properties Length: 964aa    MW: 108232 Da    PI: 7.1694
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna13363.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix26.61.5e-081892561683
                 trihelix  16 emeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfd 83 
                              ++  +  r+k ++ + +ev++++++ g++r +k+   kw+n+ ++++k+ e+e++   e++ + +yf+
  mrna13363.1-v1.0-hybrid 189 DITGQPTRAKTRADKDREVAEFLQKNGINRDAKTAGTKWDNMLGEFRKVYEWERGADREQVGNKSYFR 256
                              66667778899999*****************************************9888888999985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500118.938669950IPR000719Protein kinase domain
SuperFamilySSF561123.56E-14813954IPR011009Protein kinase-like domain
Gene3DG3DSA:1.10.510.101.1E-5821951No hitNo description
CDDcd001803.18E-11826949No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006468Biological Processprotein phosphorylation
GO:0004672Molecular Functionprotein kinase activity
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 964 aa     Download sequence    Send to blast
MGETKGDNPN IQHQQPQQTQ QHQQISTSPN DPLEEASPLT VAVTGATAPF NIPAPLYVPI  60
SGATSSSLPF DQSQFEAVNP KRPRYTSTGQ WKLLPSPSSQ QKQTPTQTTG ASSSDTASSP  120
PHSPLPSLSA TSGQDTTKTE GEEQNPSLHR SQFRRGKYVS PVWKPHEMLW LAKAWRAVYQ  180
SQGSEHHSDI TGQPTRAKTR ADKDREVAEF LQKNGINRDA KTAGTKWDNM LGEFRKVYEW  240
ERGADREQVG NKSYFRLSPY ERKLHRLPAS FDEEVFDELA QFMGSRMRTP PISRAADSTR  300
SQSLYVTTSS VLPQPPSFRE EDLPNSGRAR QLMIMTGGGE GPFYPRSGSL LGFDHLPHYH  360
HQSSLDYVAG VSSSTSLTKE LRRIGKIRMT WEESVSLWGE EGEHHRGRIK IQGGSSFLNA  420
DELAYFDDSL VACTMEAFED GPFRGFSVDR FVSGQQVKVF GRRKPSTPGP GLTVAAMPPW  480
EFQDPSEYYI TCLRVPPQSL PRLSDLSSYL LQPPPEEFRF PLRKDVYRDL PPGRESFFTT  540
SNDLLDCRAI TYDIVSTIIR SNYGIGATTS RDSFIGLWDD CINRFVSKFC CVDMVFVRKA  600
TSSISTTEAL QDQWPNVTGF VKNFCLWRGE ETDQVREGHI HPSKSLVEKL QWTYTDLPYI  660
FGYYSIGSLV TFCALSKGGQ DQVIQTNLQT LDQSLPSDRL KALVLCYRVA GLLPLLADRC  720
LNMIHSGTTS TSNGGAPSYK FMLLPYSDFE RVDLRNGNIV ELTPNTVTRF FSNQRKWSAV  780
KEIYDFLDHR IPHAECIHRS SEKDLALVFK PRGCKFKPRN CDELVEALKY VTKALVALHD  840
LSFMHRDIGW DKVMRSTERD NEWLLCGFDE AVGAPQLNPY SVAAAERGEH APELERALHG  900
VKVDVWGVGH LVRSCGLAGV PKMLRELQNR CLEQNPELRP TAAECYHHLL QLQSSLSVVT  960
AMM*
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna13363.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011470421.10.0PREDICTED: uncharacterized protein LOC101303380 isoform X1
RefseqXP_011470422.10.0PREDICTED: uncharacterized protein LOC101303380 isoform X2
TrEMBLA0A2P6SMQ80.0A0A2P6SMQ8_ROSCH; Uncharacterized protein
STRINGXP_004309245.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF118572831
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33550.17e-07Trihelix family protein