PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna13306.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family HD-ZIP
Protein Properties Length: 928aa    MW: 102128 Da    PI: 6.8124
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna13306.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.91.3e-21112167156
                              TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                 Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                              ++k +++t++q++eLe++F+++++p++++r +L+++lgL+++qVk+WFqNrR+++k
  mrna13306.1-v1.0-hybrid 112 KKKYHRHTPSQIQELESFFKECPHPDEKQRSDLSRRLGLETKQVKFWFQNRRTQMK 167
                              79999************************************************999 PP

2START172.92e-543235391204
                              HHHHHHHHHHHHHHHHC-TT-EEEE.......EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-T CS
                    START   1 elaeeaaqelvkkalaeepgWvkss.......esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWde 74 
                              ela ea++elv++a+a++p+W+kss         e ++++  +     +       ++a+r+s +v+ +++ lve+++d + +W+ 
  mrna13306.1-v1.0-hybrid 323 ELAGEAMDELVRMAQADSPLWMKSSdggtetlNVELYKTSSCI-----StrqsgLVTDASRDSCMVIINSMALVETMMDAN-RWTD 402
                              5799*********************886533322222222222.....2445569**************************.**** PP

                              T-S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESS CS
                    START  75 tla....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellp 149
                              +++    +a+t+  issg      g++q m aelq+lsplvp R   f+R+++ql +g+w++vdvSvd  q+ +    ++ +++lp
  mrna13306.1-v1.0-hybrid 403 MFPtlvsRASTIGIISSGpsgtrnGTIQMMLAELQMLSPLVPvRPLKFLRFSKQLAEGVWAVVDVSVDIHQDAS----SMNCRRLP 484
                              ************************************************************************87....699999** PP

                              EEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXX CS
                    START 150 Sgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqc 204
                              Sg+++++++ng+skvtw+eh +++++ +h+ll++l++sg+ +ga++w+ tlqr c
  mrna13306.1-v1.0-hybrid 485 SGFIVQDVPNGYSKVTWIEHSEYNESGVHQLLQPLLRSGIGFGAQRWLTTLQREC 539
                              *****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-2298169IPR009057Homeodomain-like
SuperFamilySSF466894.05E-20100169IPR009057Homeodomain-like
PROSITE profilePS5007117.912109169IPR001356Homeobox domain
SMARTSM003894.0E-19111173IPR001356Homeobox domain
CDDcd000861.94E-19112169No hitNo description
PfamPF000463.6E-19112167IPR001356Homeobox domain
PROSITE patternPS000270144167IPR017970Homeobox, conserved site
PROSITE profilePS5084840.8314544IPR002913START domain
SuperFamilySSF559613.3E-28318541No hitNo description
CDDcd088753.12E-96322539No hitNo description
SMARTSM002345.5E-41323541IPR002913START domain
PfamPF018524.9E-47323539IPR002913START domain
SuperFamilySSF559618.63E-15569787No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 928 aa     Download sequence    Send to blast
MNFGGSVSDS GGVGGSRVVA EIDPHSSGGA IAQPHFTPNS MQSSSALSLS IVQQNMDGHG  60
DLDLIAESFD PGIIGRLRED EFEQSRSGSE HFDGASGDDQ DPADEDDHPR RKKKYHRHTP  120
SQIQELESFF KECPHPDEKQ RSDLSRRLGL ETKQVKFWFQ NRRTQMKTQL ERHENIILRQ  180
ENDKLRAENG VMKDAMSNPI CHNCGGPAIP GQISFDEHQL RIENARLNDE LSRICTLAQK  240
FLGRPISNLA APPSLPSSTA GLDLAMGING MGGLHAGSSH RLSMGFELGD GVGSSSPMMP  300
LTKPAIGMPN ELQHLNDRHV YLELAGEAMD ELVRMAQADS PLWMKSSDGG TETLNVELYK  360
TSSCISTRQS GLVTDASRDS CMVIINSMAL VETMMDANRW TDMFPTLVSR ASTIGIISSG  420
PSGTRNGTIQ MMLAELQMLS PLVPVRPLKF LRFSKQLAEG VWAVVDVSVD IHQDASSMNC  480
RRLPSGFIVQ DVPNGYSKVT WIEHSEYNES GVHQLLQPLL RSGIGFGAQR WLTTLQRECD  540
ALSFLMSSAN PNEVPRGLSM NSKKSMLRLA QRMMQSFCSG VCGSLVHQWD KLCIDNVSDN  600
VRVMVRQSLE VGEPSGFVLS AATSVWMPVS RSRLFDFLRN WQLRGQWDIL VGCRPLQAMV  660
QIDKDHEGGN SVSLFNAKGL DASNNNNMLM FQETMTDASG SIIVYAPITS TSSDIMRDVV  720
YEGGDSTYVE LLPSGFAILP CVTSEYVKEE GNGSDEGGCL LTVGFQIVCD GGQPTSKLTM  780
HSVRIVVTDR KLQVSNINWS TIPLGTMLNV HNFQKPKQEK VLDYNLSLRR GKSLRKTDWR  840
RSSNVITTMQ SSGRACATHP SISAVHFEKV KSPRQMDGGD GRKRMRMIPT MLTDLLPFNG  900
PLRQALRSTA HPPSPNSLRA ARDLSLL*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna13306.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004309219.20.0PREDICTED: homeobox-leucine zipper protein HDG1 isoform X1
SwissprotQ9M2E80.0HDG1_ARATH; Homeobox-leucine zipper protein HDG1
TrEMBLA0A2P6SMY10.0A0A2P6SMY1_ROSCH; Putative transcription factor & lipid binding Homobox-WOX family
STRINGXP_004309219.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Horstman A, et al.
    AIL and HDG proteins act antagonistically to control cell proliferation.
    Development, 2015. 142(3): p. 454-64
    [PMID:25564655]