PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna13188.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB_related
Protein Properties Length: 349aa    MW: 38234 Da    PI: 9.4485
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna13188.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.33.1e-1285129147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              r +WT+ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  mrna13188.1-v1.0-hybrid  85 RESWTEPEHDKFLEALQLFDRD-WKKIEAFIG-SKTVIQIRSHAQKY 129
                              789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.43E-1679135IPR009057Homeodomain-like
PROSITE profilePS5129413.75880134IPR017930Myb domain
TIGRFAMsTIGR015572.7E-1883132IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.605.1E-683135IPR009057Homeodomain-like
SMARTSM007179.6E-1084132IPR001005SANT/Myb domain
PfamPF002497.0E-1085129IPR001005SANT/Myb domain
CDDcd001671.59E-787130No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MVEKSHNSAP SEKKPKNPTP FSNLFMVSKN PNPPEGLYLD PDEMALPGLG PFATAATTTA  60
VSTTTSSAED LSKKIRKPYT ITKSRESWTE PEHDKFLEAL QLFDRDWKKI EAFIGSKTVI  120
QIRSHAQKYF LKVQKNGTSE HLPPPRPKRK ASHPYPQKAS KNALALPQVS GSCQSSSALL  180
ESGFNQRPDS ASVLISPRAG GVVPSWPNGS VQTANPSHEN KGPTRPSCHS AESTPKAQPA  240
SETTDQGKRS QNHGQHPLRV LPDFSQVYGF IGSVFDPNIS GHLQTLKKMD PIDVETVLLL  300
MRNLSMNLTS PDFEDHRKLL SSYKIDGDST DHLDVSKSLH TDEHKSVA*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00625PBMTransfer from PK02532.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna13188.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9674400.0GU967440.1 Rosa rugosa putative MYB transcription factor (MYB1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004308049.10.0PREDICTED: protein REVEILLE 6-like
SwissprotQ8H0W31e-120RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A2P6SNC30.0A0A2P6SNC3_ROSCH; Putative transcription factor MYB-HB-like family
STRINGXP_004308049.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.11e-120MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]