PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna13035.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family WOX
Protein Properties Length: 276aa    MW: 31099.5 Da    PI: 5.2207
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna13035.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox68.49.2e-2291151257
                              T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                 Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                              r+R+t+t+ ql++Le+lF + n +ps+++++e++++l    +++e++V++WFqNrRa+ k+
  mrna13035.1-v1.0-hybrid  91 RQRWTPTPVQLQILEQLFDQgNGTPSKQKIKEITSELsqhgQISETNVYNWFQNRRARSKR 151
                              89*****************99**************************************97 PP

2Wus_type_Homeobox102.43.1e-3390153265
        Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                              ar+RWtPtp Q++iLe+l+++G  tP+k++i++it+eL+++G+i+++NV++WFQNr+aR+++kq
  mrna13035.1-v1.0-hybrid  90 ARQRWTPTPVQLQILEQLFDQGNGTPSKQKIKEITSELSQHGQISETNVYNWFQNRRARSKRKQ 153
                              789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.0E-1885157IPR009057Homeodomain-like
PROSITE profilePS5007115.15987152IPR001356Homeobox domain
SMARTSM003891.0E-1489156IPR001356Homeobox domain
SuperFamilySSF466896.42E-1989155IPR009057Homeodomain-like
PfamPF000461.5E-1991151IPR001356Homeobox domain
CDDcd000861.11E-1291153No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MEWDKQHQQK EQEIDGNGNG NGNGGVGFVK VMTDEQLETL RKQIAVYATI CEQLVEMHKN  60
LTAQQDLAGV RMGNLYCDPL MTSSGHKITA RQRWTPTPVQ LQILEQLFDQ GNGTPSKQKI  120
KEITSELSQH GQISETNVYN WFQNRRARSK RKQQNATSNN AESEVETEVD SPKDKKKGPQ  180
DQILQSQQNI SAQRAEDLCF QNPEMSSDLH FLDPQGIKED KMFASSSDLR LSRGLGHMSF  240
YDEVLSSSRG NELMTGKMEV GGSYNLFQQA EDYSM*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1144152RRARSKRKQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00617PBMTransfer from AT4G35550Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna13035.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004287723.10.0PREDICTED: WUSCHEL-related homeobox 8
SwissprotO817889e-92WOX13_ARATH; WUSCHEL-related homeobox 13
TrEMBLA0A2P6RL800.0A0A2P6RL80_ROSCH; Putative transcription factor Homobox-WOX family
STRINGXP_004287723.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18553493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.18e-94WUSCHEL related homeobox 13
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Dolzblasz A, et al.
    Stem Cell Regulation by Arabidopsis WOX Genes.
    Mol Plant, 2016. 9(7): p. 1028-39
    [PMID:27109605]