PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna12741.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family GRF
Protein Properties Length: 544aa    MW: 58521.7 Da    PI: 8.2798
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna12741.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.47e-25148191144
                      WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                              d+epgrC+RtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
  mrna12741.1-v1.0-hybrid 148 DPEPGRCKRTDGKKWRCSRDVAPDQKYCERHMHRGRPRSRKHVE 191
                              79****************************************97 PP

2QLQ55.32e-1988120234
                      QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqa 34 
                              +FT++Q+ +L++Q+++yKy++a++PvP +Ll++
  mrna12741.1-v1.0-hybrid  88 PFTNQQWKELERQAMIYKYMMASLPVPRDLLFP 120
                              8*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009519.3E-1087123IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.9E-1388120IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.40388123IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.202148192IPR014977WRC domain
PfamPF088791.7E-20149191IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009001anatomyfruit
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007027developmental stagewhole plant fruit formation stage 70% to final size
Sequence ? help Back to Top
Protein Sequence    Length: 544 aa     Download sequence    Send to blast
MMMMVHHDNR GRPDQRRDGG DGPTCNRPPG VAEPVAGSSS SNSTSGGSVL RGLQPFQCLS  60
NTNTHHHNST SLRSPGGMTT AAAALGFPFT NQQWKELERQ AMIYKYMMAS LPVPRDLLFP  120
TTTTSSSSIS QSPLSGGGFN LRLSNSTDPE PGRCKRTDGK KWRCSRDVAP DQKYCERHMH  180
RGRPRSRKHV EIHANNTTTT AATMTTAKKL RRDNNSNNIP PICAHNLPNP EMSKNGYPTQ  240
FFGSTLQTFH QTPVSLDKSG VKSATFGGGV NSVSSHRGVR GMEWMMKSEA PAISSSDAQW  300
QNLMHSNKTE LSSCSRIPYF DANTSIFGQR SEQECYLNLN SYTSFNAGDA RHQQDDNDCT  360
MFLSPDVVAL ENPLLEETPR SFIDAWSKND NGDNITSVPS SGHLSPSSLT LSMGGYNSIS  420
DEMGQTQMSL GCNDGSGNET RPPQITTWLT PSSWVSSPPG GPLAEVLKPA TSAASTPSSP  480
ITTNGNHGEF SSPLGTTTAS SPSGVLQKTL ASFSDSSGNS SPNLTSSKPK TEAVSLWLNQ  540
SKS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapmrna12741.1-v1.0-hybrid
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004307906.10.0PREDICTED: growth-regulating factor 3
TrEMBLA0A2P6SPE70.0A0A2P6SPE7_ROSCH; Putative transcription factor interactor and regulator C3H-WRC/GRF family
STRINGXP_004307906.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.11e-33growth-regulating factor 7