PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna11979.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family bZIP
Protein Properties Length: 536aa    MW: 58896.3 Da    PI: 8.3999
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna11979.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_126.91e-0882125750
                              HHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   7 errkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                               rr   NReA r++R++Kka ++ Lee+vk+L+  N++L  +l+
  mrna11979.1-v1.0-hybrid  82 RRRPSGNREAVRKYREKKKAHTAYLEEEVKKLQLLNQQLVRKLQ 125
                              455566*********************************98887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.0E-873143IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.0E-1281143No hitNo description
PROSITE profilePS502178.63481125IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.75E-781126No hitNo description
CDDcd146863.80E-1081133No hitNo description
PfamPF077161.2E-1381133IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 536 aa     Download sequence    Send to blast
MDDGEVETLD HAVIPKSNSS GNFHTPTSID TLRTCLHTHT CNLPGPDAAH THTCYHTHTQ  60
VLPSEENDGD HSKEDLVLKP KRRRPSGNRE AVRKYREKKK AHTAYLEEEV KKLQLLNQQL  120
VRKLQGQASL EAEFLRLRNL LLDFRGKIDS ELGAFPFEKQ YYKPGVISKE GDCELQSNVG  180
ETGIRCQIDL PCFCPPAVGL SLEAGIEASE KTMASFGGNC QSPVIECRDH PKVMASAEVL  240
KLGQLGRVLG TRLVTVAILA YSVPLVGQQK IGRSLAPEAQ SLISRSSRSQ SLSVAQSLSL  300
TSPARPPRQS ASSRPVRLLS QGWIVDGGDD DVVSDLPSER VGEESGVDGG LEPRRGPRIQ  360
EIRELDEDSL LKQRSPGEAS SLLCHRASSL SLFPSLKCGT IRLSVCKQAH MDVNHRLGLL  420
QRRPYLEAVG DLEQECMKLI LVCKNLIDIR DITIFFALEA NELGQKTKPK DLKPYRAAAQ  480
GRFSRLTKLA RTSPPGAAHY CRTPSLVELL ATHAATTCSH RVPKVNIWCI VGVKQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1352357PRRGPR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25673277
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.11e-22bZIP family protein